Property Summary

Ligand Count 1
NCBI Gene PubMed Count 38
PubMed Score 51.56
PubTator Score 44.44

Knowledge Summary

Patent (10,086)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Patterned dystrophy of retinal pigment epithelium 3 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.7e-08
malignant mesothelioma 3232 4.4e-07
tuberculosis 2010 3.5e-06
ependymoma 4679 7.3e-06
colon cancer 1478 5.5e-04
glioblastoma 5792 1.4e-03
osteosarcoma 7950 2.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer 1.200 5.5e-04
ependymoma 1.200 7.3e-06
glioblastoma 1.100 1.4e-03
malignant mesothelioma -2.000 4.4e-07
osteosarcoma -1.052 2.3e-03
psoriasis 1.400 2.7e-08
tuberculosis 1.300 3.5e-06

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (13)

AA Sequence

MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLECFHRRTGQKC      1 - 70
ALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMECMEGGELFSRIQERGDQAFTE     71 - 140
REAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVA    141 - 210
PEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQL    211 - 280
IRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVK    281 - 350
IKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ                                          351 - 382
//

Text Mined References (48)

PMID Year Title