Property Summary

NCBI Gene PubMed Count 87
PubMed Score 388.53
PubTator Score 282.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Barth syndrome 23 0.0 5.0
Disease Target Count P-value
osteosarcoma 7950 1.5e-06
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.627 1.5e-06

 OMIM Phenotype (1)

Gene RIF (47)

AA Sequence

MPLHVKWPFPAVPPLTWTLASSVVMGLVGTYSCFWTKYMNHLTVHNREVLYELIEKRGPATPLITVSNHQ      1 - 70
SCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDT     71 - 140
GRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWGIGRLIAECHLNPIIL    141 - 210
PLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQ    211 - 280
AEQLHNHLQPGR                                                              281 - 292
//

Text Mined References (88)

PMID Year Title