Property Summary

NCBI Gene PubMed Count 42
PubMed Score 94.35
PubTator Score 62.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Hanot's cirrhosis 8
Disease Target Count P-value
periodontitis 269 1.66940950931547E-32
non-small cell lung carcinoma 413 2.41437668959922E-13
osteosarcoma 7933 2.46529133000152E-13
lung adenocarcinoma 2714 1.50253042434908E-12
ulcerative colitis 2087 1.80432312351484E-6
interstitial cystitis 2299 5.38345363102082E-6
posterior fossa group B ependymoma 1530 7.04675617187167E-6
psoriasis 6685 4.58466903287997E-5
cystic fibrosis 1670 1.51447391140755E-4
medulloblastoma, large-cell 6234 2.50037638239379E-4
lung carcinoma 2844 2.54793257385344E-4
lung cancer 4473 0.00131124873599763
cutaneous lupus erythematosus 1056 0.0017235766216614
adult high grade glioma 2148 0.00185229518033654
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00191283514783123
nasopharyngeal carcinoma 1056 0.0027317241613681
Breast cancer 3099 0.00424389724466539
chronic rhinosinusitis 512 0.00498689424865347
X-linked agammaglobulinemia 7 0.00875454880680206
primary Sjogren syndrome 789 0.0294127489280664
head and neck cancer and chronic obstructive pulmonary disease 237 0.0357407224421342
pancreatic cancer 2300 0.0383675488313368
pancreatic carcinoma 567 0.0383675488313369
Barrett's esophagus 185 0.0400352030718182
colon cancer 1475 0.0477111192563626
Disease Target Count Z-score Confidence
Primary biliary cirrhosis 45 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Lymphoma 57 4.354 2.2

Expression

  Differential Expression (25)

Synonym

Accession Q16633 B2R8Z9 Q14983
Symbols BOB1
OBF1
OCAB
OBF-1

Gene

PDB

1CQT  

  Ortholog (12)

Gene RIF (20)

PMID Text
26927796 these findings suggest a novel function of POU2AF1 as a potential regulator of host defense genes in the human airway epithelium.
24005100 It has been identified as a new disease susceptibility gene among Japanese. Though different from Europeans, it is indicated that a B lymphocyte differentiation route shares a common disease developing process. [Review]
23000144 Two significant susceptibility loci, TNFSF15 (rs4979462) and POU2AF1 (rs4938534) (combined odds ratio [OR] = 1.56, p = 2.84 x 10(-14) for rs4979462.
21905497 genetic polymorphism is associated with common variable immunodeficiency
21549311 Data show that Igh 3' enhancer-bound OCA-B and promoter-bound TFII-I mediate promoter-enhancer interactions, in both cis and trans, that are important for Igh transcription.
21424034 Twenty-two cases of nodular lymphocyte predominant Hodgkin lymphoma were studied for the immunohistochemical expression of Pax-5, Oct-2, BOB.1, Bcl-6 protein and MUM1/IRF-4.
20659471 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20141429 On multivariate analysis, co-expression of OCT-2/BOB.1 remained predictive for achievement of complete remission and increased risk of relapse.
20102401 BOB.1 may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma
More...

AA Sequence

MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDM      1 - 70
EGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVL     71 - 140
TYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPI    141 - 210
SIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF                            211 - 256
//

Text Mined References (43)

PMID Year Title
26927796 2016 POU2AF1 Functions in the Human Airway Epithelium To Regulate Expression of Host Defense Genes.
24005100 2013 [Analysis of disease-pathway by susceptibility genes in primary biliary cirrhosis].
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23000144 2012 Genome-wide association study identifies TNFSF15 and POU2AF1 as susceptibility loci for primary biliary cirrhosis in the Japanese population.
21905497 2011 Evaluation of CARMA1/CARD11 and Bob1 as candidate genes in common variable immunodeficiency.
21549311 2011 Direct interactions of OCA-B and TFII-I regulate immunoglobulin heavy-chain gene transcription by facilitating enhancer-promoter communication.
21424034 2011 B-cell transcription factors Pax-5, Oct-2, BOB.1, Bcl-6, and MUM1 are useful markers for the diagnosis of nodular lymphocyte predominant Hodgkin lymphoma.
20659471 2010 Genetic heterogeneity in colorectal cancer associations between African and European americans.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20141429 2010 OCT-2 expression and OCT-2/BOB.1 co-expression predict prognosis in patients with newly diagnosed acute myeloid leukemia.
More...