Property Summary

NCBI Gene PubMed Count 45
PubMed Score 96.31
PubTator Score 62.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Primary biliary cirrhosis 51 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma 1.200 1.9e-03
Barrett's esophagus 1.700 4.0e-02
Breast cancer -1.200 4.2e-03
chronic rhinosinusitis -2.545 5.0e-03
colon cancer -2.000 4.8e-02
cutaneous lupus erythematosus 4.100 1.7e-03
cystic fibrosis -1.300 1.5e-04
head and neck cancer and chronic obstruc... -1.500 3.6e-02
interstitial cystitis 2.700 1.6e-03
intraductal papillary-mucinous adenoma (... 3.200 1.9e-03
lung adenocarcinoma 1.100 2.0e-04
lung cancer -2.800 1.3e-03
lung carcinoma -1.100 2.5e-04
medulloblastoma, large-cell 1.800 2.5e-04
nasopharyngeal carcinoma -1.200 2.7e-03
non-small cell lung cancer 1.106 1.7e-03
osteosarcoma -7.929 2.5e-13
pancreatic cancer 1.200 3.8e-02
pancreatic carcinoma 1.200 3.8e-02
periodontitis 2.400 1.7e-32
posterior fossa group A ependymoma 1.600 3.1e-04
primary Sjogren syndrome 1.800 2.9e-02
psoriasis -2.500 4.6e-05
ulcerative colitis 4.100 1.8e-06
X-linked agammaglobulinemia -1.664 8.8e-03

Gene RIF (22)

AA Sequence

MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDM      1 - 70
EGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVL     71 - 140
TYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPI    141 - 210
SIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF                            211 - 256
//

Text Mined References (46)

PMID Year Title