Property Summary

NCBI Gene PubMed Count 41
PubMed Score 34.37
PubTator Score 38.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 4.33942887835224E-24
malignant mesothelioma 3163 5.35793861307545E-7
acute quadriplegic myopathy 1157 1.84778516536203E-6
group 3 medulloblastoma 2254 2.55411574338232E-4
lung cancer 4473 2.77973161608076E-4
diabetes mellitus 1663 0.00106283354735609
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00137401520945958
atypical teratoid / rhabdoid tumor 4369 0.00193005372545416
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00239788362055322
glioblastoma 5572 0.00256658641684246
ovarian cancer 8492 0.0025677357384331
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00855649168785478
Multiple myeloma 1328 0.0162120919303765
astrocytoma 1493 0.0377327695761027
subependymal giant cell astrocytoma 2287 0.0469656600167824

Expression

Synonym

Accession Q16630 A8K7K9 Q53ES1 Q9BSJ7 Q9BW18
Symbols CFIM
CFIM68
HPBRII-4
HPBRII-7

Gene

PDB

3P5T   3P6Y   3Q2S   3Q2T   4B4N   4U0A   4U0B   4WYM  

  Ortholog (12)

Gene RIF (50)

PMID Text
26858452 integration targeting proceeds via two distinct mechanisms: capsid-CPSF6 binding directs HIV-1 to actively transcribed euchromatin, where the integrase-LEDGF/p75 interaction drives integration into gene bodies.
25774576 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25731773 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25518861 Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
25518861 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25517934 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25496772 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25356722 NUP153 and CPSF6 have overlapping binding sites, but each makes unique capsid monomers (CA) interactions. Multiple ligands share an overlapping interface in HIV-1 capsid that is lost upon viral disassembly.
25356722 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25320302 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
More...

AA Sequence

MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAP      1 - 70
NVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKL     71 - 140
MDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGA    141 - 210
VPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFP    211 - 280
GQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGA    281 - 350
PPPAPHVNPAFFPPPTNSGMPTSDSRGPPPTDPYGRPPPYDRGDYGPPGREMDTARTPLSEAEFEEIMNR    351 - 420
NRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGSGSR    421 - 490
RERSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDRERDREREYRHR             491 - 551
//

Text Mined References (48)

PMID Year Title
26858452 2016 A critical role for alternative polyadenylation factor CPSF6 in targeting HIV-1 integration to transcriptionally active chromatin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25518861 2014 Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
25416956 2014 A proteome-scale map of the human interactome network.
25356722 2014 Host cofactors and pharmacologic ligands share an essential interface in HIV-1 capsid that is lost upon disassembly.
24986923 2014 A genome-wide association study identifies susceptibility loci of silica-related pneumoconiosis in Han Chinese.
24415937 2014 In vivo functions of CPSF6 for HIV-1 as revealed by HIV-1 capsid evolution in HLA-B27-positive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23658440 2013 A carboxy-terminally truncated human CPSF6 lacking residues encoded by exon 6 inhibits HIV-1 cDNA synthesis and promotes capsid disassembly.
23622145 2013 The ability of TNPO3-depleted cells to inhibit HIV-1 infection requires CPSF6.
More...