Property Summary

NCBI Gene PubMed Count 41
Grant Count 20
R01 Count 6
Funding $3,444,258.82
PubMed Score 34.37
PubTator Score 38.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (70)

PMID Text
26858452 integration targeting proceeds via two distinct mechanisms: capsid-CPSF6 binding directs HIV-1 to actively transcribed euchromatin, where the integrase-LEDGF/p75 interaction drives integration into gene bodies.
25774576 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25731773 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25731773 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25731773 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25518861 Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
25518861 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25518861 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25517934 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
25496772 HIV-1 CA binds CPSF6; this interaction is inhibited by the inhibitor BI-2
More...

AA Sequence

MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAP      1 - 70
NVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKL     71 - 140
MDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGA    141 - 210
VPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFP    211 - 280
GQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGA    281 - 350
PPPAPHVNPAFFPPPTNSGMPTSDSRGPPPTDPYGRPPPYDRGDYGPPGREMDTARTPLSEAEFEEIMNR    351 - 420
NRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGSGSR    421 - 490
RERSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDRERDREREYRHR             491 - 551
//

Text Mined References (48)

PMID Year Title
26858452 2016 A critical role for alternative polyadenylation factor CPSF6 in targeting HIV-1 integration to transcriptionally active chromatin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25518861 2014 Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
25416956 2014 A proteome-scale map of the human interactome network.
25356722 2014 Host cofactors and pharmacologic ligands share an essential interface in HIV-1 capsid that is lost upon disassembly.
24986923 2014 A genome-wide association study identifies susceptibility loci of silica-related pneumoconiosis in Han Chinese.
24415937 2014 In vivo functions of CPSF6 for HIV-1 as revealed by HIV-1 capsid evolution in HLA-B27-positive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23658440 2013 A carboxy-terminally truncated human CPSF6 lacking residues encoded by exon 6 inhibits HIV-1 cDNA synthesis and promotes capsid disassembly.
23622145 2013 The ability of TNPO3-depleted cells to inhibit HIV-1 infection requires CPSF6.
More...