Property Summary

NCBI Gene PubMed Count 44
Grant Count 15
R01 Count 10
Funding $1,400,558.57
PubMed Score 12.10
PubTator Score 23.56

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

Gene RIF (19)

PMID Text
25482508 Genome-wide identification of CD95 antigen alternative splicing regulators, such as SRSF7, reveals links with iron homeostasis.
25416801 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
24330569 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
23125841 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
23125841 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
23125841 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
23125841 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
22677170 Cyclic AMP-dependent protein kinase regulates 9G8-mediated alternative splicing of tau exon 10
21755018 Upregulation of total tau expression (SFRS7-independent) and tau exon 10 splicing (SFRS7-dependent), as shown in this study to be both affected by STOX1A, is known to have implications in neurodegeneration.
21215488 Coexpression of Dyrk1A and splicing factor 9G8 leads to their translocation from the nucleus to the cytoplasm and suppresses their ability to regulate tau exon 10 splicing.
More...

AA Sequence

MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK      1 - 70
VICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRG     71 - 140
RRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSR    141 - 210
SKSRSPSPKRSRSPSGSPRRSASPERMD                                              211 - 238
//

Text Mined References (54)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25482508 2015 Genome-wide identification of Fas/CD95 alternative splicing regulators reveals links with iron homeostasis.
25416956 2014 A proteome-scale map of the human interactome network.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22677170 2012 Cyclic AMP-dependent protein kinase regulates 9G8-mediated alternative splicing of tau exon 10.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21755018 2011 SFRS7-mediated splicing of tau exon 10 is directly regulated by STOX1A in glial cells.
More...