Property Summary

NCBI Gene PubMed Count 47
PubMed Score 12.88
PubTator Score 23.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

 MGI Phenotype (1)

Gene RIF (18)

AA Sequence

MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK      1 - 70
VICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRG     71 - 140
RRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSR    141 - 210
SKSRSPSPKRSRSPSGSPRRSASPERMD                                              211 - 238
//

Text Mined References (58)

PMID Year Title