Property Summary

NCBI Gene PubMed Count 44
PubMed Score 12.10
PubTator Score 23.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.69492636493128E-11
ovarian cancer 8492 4.44162332021224E-8
juvenile dermatomyositis 1189 7.22597602911961E-8
osteosarcoma 7933 1.31287055737398E-4
dermatomyositis 967 2.17512030154977E-4
group 3 medulloblastoma 2254 2.93072923743855E-4
chronic lymphosyte leukemia 232 4.10166052373597E-4
acute quadriplegic myopathy 1157 6.08605883600967E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 6.1108790915106E-4
oligodendroglioma 2849 7.42383948877386E-4
astrocytoma 1493 8.90103779850418E-4
ependymoma 2514 0.00104944425701592
nasopharyngeal carcinoma 1056 0.00167329634056192
primitive neuroectodermal tumor 3031 0.00180392612857058
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00197449191131811
glioblastoma 5572 0.00294818057710319
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00850855900639237
Polycystic Ovary Syndrome 335 0.0089582341711713
subependymal giant cell astrocytoma 2287 0.023068923140651
Gaucher disease type 1 171 0.0307129288530595
active ulcerative colitis 477 0.0317313763683826
Disease Target Count Z-score Confidence
Hypobetalipoproteinemia 2 3.183 1.6

Expression

Synonym

Accession Q16629 B4DLU6 G5E9M3 Q564D3
Symbols 9G8
AAG3
SFRS7

Gene

PDB

2HVZ  

  Ortholog (12)

 MGI Term (1)

Gene RIF (16)

PMID Text
25482508 Genome-wide identification of CD95 antigen alternative splicing regulators, such as SRSF7, reveals links with iron homeostasis.
25416801 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
24330569 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
23125841 SRSF7 (serine/arginine-rich splicing factor 7) inhibits HIV-1 Tat-mediated transactivation activity in HEK293 cells
22677170 Cyclic AMP-dependent protein kinase regulates 9G8-mediated alternative splicing of tau exon 10
21755018 Upregulation of total tau expression (SFRS7-independent) and tau exon 10 splicing (SFRS7-dependent), as shown in this study to be both affected by STOX1A, is known to have implications in neurodegeneration.
21215488 Coexpression of Dyrk1A and splicing factor 9G8 leads to their translocation from the nucleus to the cytoplasm and suppresses their ability to regulate tau exon 10 splicing.
20227104 The authors report that siRNA knockdown of SRp20 or 9G8 resulted in about a 10 fold decrease in herpes simplex virus 1 yields and in nuclear accumulation of polyA+ RNA.
19854136 eIF3f mediates restriction of HIV-1 expression through a set of factors that includes eIF3f, the SR protein 9G8, and the cyclin-dependent kinase 11 (CDK11).
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
More...

AA Sequence

MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK      1 - 70
VICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRG     71 - 140
RRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSR    141 - 210
SKSRSPSPKRSRSPSGSPRRSASPERMD                                              211 - 238
//

Text Mined References (54)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25482508 2015 Genome-wide identification of Fas/CD95 alternative splicing regulators reveals links with iron homeostasis.
25416956 2014 A proteome-scale map of the human interactome network.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22677170 2012 Cyclic AMP-dependent protein kinase regulates 9G8-mediated alternative splicing of tau exon 10.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21755018 2011 SFRS7-mediated splicing of tau exon 10 is directly regulated by STOX1A in glial cells.
More...