Property Summary

NCBI Gene PubMed Count 27
PubMed Score 18.94
PubTator Score 261.88

Knowledge Summary

Patent

No data available

Gene RIF (15)

AA Sequence

MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR      1 - 70
GHSVCTNPSDKWVQDYIKDMKEN                                                    71 - 93
//

Text Mined References (27)

PMID Year Title