Property Summary

NCBI Gene PubMed Count 26
Grant Count 1
Funding $220,191
PubMed Score 1.18
PubTator Score 261.88

Knowledge Summary

Patent

No data available

Synonym

Accession Q16627 E1P649 E1P650 Q13954
Symbols CC-1
CC-3
CKB1
MCIF
NCC2
SY14
HCC-1
HCC-3
NCC-2
SCYL2
SCYA14
HCC-1(1-74)
HCC-1/HCC-3

Gene

 Grant Application (1)

PDB

2Q8R   2Q8T  

Gene RIF (14)

PMID Text
26155942 CCL2, 3, 14 have roles in stimulating macrophage bone marrow homing, proliferation, and polarization in multiple myeloma
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of chemokine (C-C motif) ligand 14 (CCL14) in peptide-treated PBMCs
21937684 CCL14 is a critical mediator of the JARID1B/LSD1/NuRD complex in regulation of angiogenesis and metastasis in breast cancer.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19812544 enhanced expression in intestinal epithelium in inflammatory bowel disease and display of antibacterial activity
19632987 D6 cooperates with CD26 in the negative regulation of CCL14 by the selective degradation of its biologically active isoform.
19553544 the activity of CCL14a might be regulated by stringent proteolytic activation and inactivation steps
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18602166 SLE, this study reveals strong associations with a marker and a haplotype encompassing the CCL14 gene, which suggests that a lupus relevant variant may lie within or in the proximity of this haplotype.
More...

AA Sequence

MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKR      1 - 70
GHSVCTNPSDKWVQDYIKDMKEN                                                    71 - 93
//

Text Mined References (26)

PMID Year Title
26155942 2015 Chemokines CCL2, 3, 14 stimulate macrophage bone marrow homing, proliferation, and polarization in multiple myeloma.
21937684 2011 Binding of the JmjC demethylase JARID1B to LSD1/NuRD suppresses angiogenesis and metastasis in breast cancer cells by repressing chemokine CCL14.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19812544 2010 A novel role for constitutively expressed epithelial-derived chemokines as antibacterial peptides in the intestinal mucosa.
19632987 2009 Recognition versus adaptive up-regulation and degradation of CC chemokines by the chemokine decoy receptor D6 are determined by their N-terminal sequence.
19553544 2009 Significance of N-terminal proteolysis of CCL14a to activity on the chemokine receptors CCR1 and CCR5 and the human cytomegalovirus-encoded chemokine receptor US28.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
18602166 2008 CCL genes in multiple sclerosis and systemic lupus erythematosus.
18367676 2008 CX3CL1 and CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast: potential roles in human embryo implantation.
More...