Property Summary

NCBI Gene PubMed Count 8
PubMed Score 71.94
PubTator Score 15.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung cancer 4473 8.16247921369508E-4
ovarian cancer 8492 0.00223961018591621
Disease Target Count Z-score Confidence
Myoma 12 3.531 1.8
Parkinson's disease 364 3.192 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.200 0.001
ovarian cancer 1.300 0.002

Synonym

Accession Q16626 Q5TC36 Q9BV01 MEA-1
Symbols HYS
MEA

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

AA Sequence

MGPERHLSGAPARMATVVLGGDTMGPERIFPNQTEELGHQGPSEGTGDWSSEEPEEEQEETGSGPAGYSY      1 - 70
QPLNQDPEQEEVELAPVGDGDVVADIQDRIQALGLHLPDPPLESEDEDEEGATALNNHSSIPMDPEHVEL     71 - 140
VKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASPAWK                             141 - 185
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12755172 2003 Peas-Mea1-Ppp2r5d overlapping gene complex: a transposon mediated-gene formation in mammals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444059 2002 Male-enhanced antigen-1 gene flanked by two overlapping genes is expressed in late spermatogenesis.
More...