Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
R01 Count 1
Funding $128,866.67
PubMed Score 71.94
PubTator Score 15.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.200 0.001
ovarian cancer 1.300 0.002

AA Sequence

MGPERHLSGAPARMATVVLGGDTMGPERIFPNQTEELGHQGPSEGTGDWSSEEPEEEQEETGSGPAGYSY      1 - 70
QPLNQDPEQEEVELAPVGDGDVVADIQDRIQALGLHLPDPPLESEDEDEEGATALNNHSSIPMDPEHVEL     71 - 140
VKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASPAWK                             141 - 185
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12755172 2003 Peas-Mea1-Ppp2r5d overlapping gene complex: a transposon mediated-gene formation in mammals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444059 2002 Male-enhanced antigen-1 gene flanked by two overlapping genes is expressed in late spermatogenesis.
More...