Property Summary

NCBI Gene PubMed Count 8
PubMed Score 80.06
PubTator Score 15.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.200 8.2e-04
ovarian cancer 1.300 2.2e-03

AA Sequence

MGPERHLSGAPARMATVVLGGDTMGPERIFPNQTEELGHQGPSEGTGDWSSEEPEEEQEETGSGPAGYSY      1 - 70
QPLNQDPEQEEVELAPVGDGDVVADIQDRIQALGLHLPDPPLESEDEDEEGATALNNHSSIPMDPEHVEL     71 - 140
VKRTMAGVSLPAPGVPAWAREISDAQWEDVVQKALQARQASPAWK                             141 - 185
//

Text Mined References (12)

PMID Year Title