Property Summary

NCBI Gene PubMed Count 165
PubMed Score 1301.01
PubTator Score 92.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Liver cancer 604 0.0 0.6

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.600 1.1e-08
cystic fibrosis -2.806 3.4e-08
ductal carcinoma in situ 1.900 1.3e-02
ependymoma 1.800 2.4e-09
interstitial cystitis -2.100 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.500 7.1e-03
invasive ductal carcinoma 1.900 1.2e-02
lung adenocarcinoma -1.200 8.5e-04
medulloblastoma, large-cell -1.100 1.9e-02
non-small cell lung cancer -1.412 1.5e-07
osteosarcoma -1.966 1.3e-02
ovarian cancer -1.300 2.6e-07
pulmonary arterial hypertension -1.100 1.8e-02
Rheumatoid arthritis 2.500 3.0e-02
urothelial carcinoma -1.100 2.5e-02

 GWAS Trait (1)

Gene RIF (134)

AA Sequence

MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSM      1 - 70
LIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGF     71 - 140
MLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPTAQSSGSLYGS    141 - 210
QIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNIL    211 - 280
WDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV    281 - 350
VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY    351 - 420
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGS    421 - 490
ADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT                                          491 - 522
//

Text Mined References (168)

PMID Year Title