Property Summary

NCBI Gene PubMed Count 149
Grant Count 359
R01 Count 246
Funding $29,488,510.59
PubMed Score 1182.01
PubTator Score 92.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16625 B5BU70 D2DU64 D2DU65 D2IGC0 D2IGC1 E2CYV9 Q5U1V4 Q8N6K1
Symbols BLCPMG
PPP1R115

Gene

PANTHER Protein Class (2)

PDB

1WPA   1XAW   3G7C  

Gene RIF (123)

PMID Text
26977027 Occludin expression has a clear relationship with bone metastasis in human cancer.
26863122 OCLN and ZO1 levels appear to be early prognostic markers in patients suffering from sepsis.
26731658 In hepatitis C virus -infected human livers, occludin and ADRP mRNA expression levels correlated with each other. Hepatitis C virus increases occludin expression via the upregulation of ADRP.
26731262 Data show that estrogen mediates control of hepatitis C virus through the G-protein-coupled estrogen receptor 30 (GPR30) pathway leading to cleavage of occludin by Matrix Metalloproteinase-9 (MMP-9).
26689621 This is report of a family of Indian origin with two affected sibs and segregation of a homozygous novel OCLN mutation in the exon 3(NG_028291.1(OCLN_v001):c.252delC).
26662145 autotypic tight junctions molecular composition, like claudin-1 and occludin expression could influence the demyelinating process by altering the permeability of the blood-nerve barrier.
26571379 resistance to HCV in HIV+ patients may be related to genetic variation in SCARB1 or OCLN
26561856 Data show that claudin-6 (CLDN6) R209Q and occludin (OCLN) P24A mutations do not affect HCV pseudoparticles (HCVpp) entry.
26090670 Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin
26080028 Lipid raft-associated processes, such as PP2A and MMP-2 activation, participate in PCB153-induced disruption of occludin function in brain endothelial barrier.
More...

AA Sequence

MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSM      1 - 70
LIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGYGYGYGYGYGGYTDPRAAKGF     71 - 140
MLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSAILGIMVFIATIVYIMGVNPTAQSSGSLYGS    141 - 210
QIYALCNQFYTPAATGLYVDQYLYHYCVVDPQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNIL    211 - 280
WDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEV    281 - 350
VQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY    351 - 420
PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGS    421 - 490
ADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT                                          491 - 522
//

Text Mined References (151)

PMID Year Title
26977027 2016 Metastasis to Bone in Human Cancer Is Associated with Loss of Occludin Expression.
26863122 2016 PROGNOSTIC VALUE OF PLASMA TIGHT-JUNCTION PROTEINS FOR SEPSIS IN EMERGENCY DEPARTMENT: AN OBSERVATIONAL STUDY.
26731658 2016 Hepatitis C Virus Increases Occludin Expression via the Upregulation of Adipose Differentiation-Related Protein.
26731262 2016 A New Signaling Pathway for HCV Inhibition by Estrogen: GPR30 Activation Leads to Cleavage of Occludin by MMP-9.
26689621 2016 Renal dysfunction in sibs with band like calcification with simplified gyration and polymicrogyria: Report of a new mutation and review of literature.
26662145 2015 Claudin-1 and occludin expression in demyelinating peripheral neuropathies.
26571379 2015 Identification of Variants of Hepatitis C Virus (HCV) Entry Factors in Patients Highly Exposed to HCV but Remaining Uninfected: An ANRS Case-Control Study.
26561856 2015 Claudin-6 and Occludin Natural Variants Found in a Patient Highly Exposed but Not Infected with Hepatitis C Virus (HCV) Do Not Confer HCV Resistance In Vitro.
26090670 2015 Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of Occludin.
26080028 2015 Lipid rafts regulate PCB153-induced disruption of occludin and brain endothelial barrier function through protein phosphatase 2A and matrix metalloproteinase-2.
More...