Property Summary

NCBI Gene PubMed Count 144
PubMed Score 716.92
PubTator Score 324.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active ulcerative colitis 1.023 2.2e-02
adult high grade glioma -2.300 3.2e-04
astrocytic glioma -1.600 3.4e-03
Astrocytoma, Pilocytic -3.000 1.6e-09
atypical teratoid / rhabdoid tumor -3.300 2.0e-13
breast carcinoma 1.400 1.7e-06
ependymoma -2.300 7.8e-04
glioblastoma -2.400 4.8e-10
group 3 medulloblastoma -1.500 4.1e-02
intraductal papillary-mucinous neoplasm ... 1.300 7.0e-03
lung adenocarcinoma 2.400 4.1e-09
lung carcinoma 1.100 1.2e-31
medulloblastoma, large-cell -2.100 1.4e-04
oligodendroglioma -1.600 1.8e-02
Pick disease -1.500 6.9e-03
primitive neuroectodermal tumor -2.500 1.1e-05

Protein-protein Interaction (5)

Gene RIF (62)

AA Sequence

MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEK      1 - 70
TKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSD     71 - 140
YRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIR    141 - 210
ELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIA    211 - 280
STVGGIFA                                                                  281 - 288
//

Text Mined References (146)

PMID Year Title