Property Summary

NCBI Gene PubMed Count 54
Grant Count 195
R01 Count 127
Funding $35,670,018.82
PubMed Score 203.18
PubTator Score 202.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.001
pancreatic cancer 1.400 0.002
osteosarcoma -6.263 0.000
tuberculosis 2.900 0.000
non-small cell lung cancer -1.007 0.000
pancreatic carcinoma 1.400 0.002

Synonym

Accession Q16621 Q07720 Q6ICV9
Symbols p45
NF-E2

Gene

PDB

1LVX   2KZ5  

Gene RIF (30)

PMID Text
26093937 assessment of NF-E2 and NGFR expression may provide additional support in reaching a correct diagnosis in discriminating polycythemia vera from prefibrotic/fibrotic primary myelofibrosis and essential thrombocythemia
25482012 The genes BCL6, NFE2, POU4F2 and ELF4 are primary 1,25(OH)2D3 targets in THP-1 cells
24608802 A functional link among the erythroid transcription factors GATA-1/NF-E2, miR-199b-5p in erythropoiesis.
24606315 the RUNX1 target NF-E2 is part of the molecular network by which RUNX1 regulates platelet biogenesis and function in a pedigree with familial platelet disorder with a predisposition to acute myelogenous leukemia
24383889 Findings suggest a model whereby ROCK inhibition drives polyploidization, DMS growth and proplatelet formation late in megakaryocyte maturation through downregulation of MYC and NFE2 expression.
24336657 IFN-gamma modulates NF-kappaB/c-Jun to antagonize activin A-mediated NF-E2 transcriptional activity on erythroid cell globin gene expression.
24297870 RUNX1 and NF-E2 are overexpressed in polycythemic patients of diverse phenotypes and molecular causes
24196613 NF-E2 immunohistochemistry and analysis of the proportion of nuclear positive erythroblasts of all erythroid precursor cells can help to distinguish between ET and PMF even in early stages of the diseases.
23670178 Here we demonstrate that NF-E2 is mislocalized in prefibrotic primary myelofibrosis cells and that aberrant NF-E2 localization discriminates statistically highly significantly between essential thrombocytthemia and that disease.
23589569 the role of increased NF-E2 activity in the pathophysiology of myeloproliferative neoplasms, is reported.
More...

AA Sequence

MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSI      1 - 70
HPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQE     71 - 140
DPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAETPLALEPSSG    141 - 210
PVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA    211 - 280
QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEY    281 - 350
ALQQAADGTIFLVPRGTKMEATD                                                   351 - 373
//

Text Mined References (54)

PMID Year Title
26093937 2015 Nuclear factor-erythroid 2, nerve growth factor receptor, and CD34-microvessel density are differentially expressed in primary myelofibrosis, polycythemia vera, and essential thrombocythemia.
25482012 2015 The transcriptional regulator BCL6 participates in the secondary gene regulatory response to vitamin D.
25416956 2014 A proteome-scale map of the human interactome network.
24608802 2014 The up-regulation of miR-199b-5p in erythroid differentiation is associated with GATA-1 and NF-E2.
24606315 2014 Mechanisms underlying platelet function defect in a pedigree with familial platelet disorder with a predisposition to acute myelogenous leukemia: potential role for candidate RUNX1 targets.
24383889 2014 Rho kinase inhibition drives megakaryocyte polyploidization and proplatelet formation through MYC and NFE2 downregulation.
24336657 2014 Interferon-? suppresses activin A/NF-E2 induction of erythroid gene expression through the NF-?B/c-Jun pathway.
24297870 2014 RUNX1 and NF-E2 upregulation is not specific for MPNs, but is seen in polycythemic disorders with augmented HIF signaling.
24196613 2013 [Differential diagnosis of myeloproliferative neoplasms. Quantitative NF-E2 immunohistochemistry for differentiating between essential thrombocythemia and primary myelofibrosis].
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
More...