Property Summary

NCBI Gene PubMed Count 262
Grant Count 1,060
R01 Count 578
Funding $107,929,213.71
PubMed Score 1100.13
PubTator Score 600.00

Knowledge Summary

Patent (64,967)

TINX Plot

  Disease Relevance (57)

Disease Z-score Confidence
Cancer 2,346 4.188 2.1
Alzheimer's disease 644 4.178 2.1
Epilepsy 346 4.038 2.0
Schizophrenia 501 4.008 2.0
Toxic encephalopathy 131 3.996 2.0
Huntington's disease 72 3.793 1.9
Parkinson's disease 364 3.594 1.8
Cerebrovascular disease 231 3.413 1.7
Bipolar Disorder 266 3.381 1.7
Major Depressive Disorder 106 3.377 1.7
Atopic dermatitis 944
Autistic Disorder 320
Breast cancer 3,094
Carcinoma 2,147 1.0
Cocaine-Related Disorders 88
Developmental Disabilities 20
Down syndrome 548
Duchenne muscular dystrophy 602
Glioma 65
Hamman-Rich syndrome 35
Hyperactive behavior 31
Hyperphagia 4
Lewy Body Disease 19
Neuroblastoma 78
Obesity 616 4.0
Obesity, Hyperphagia, and Developmental ... 1 
Pick disease 1,893
Status Epilepticus 85
astrocytic glioma 2,241
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
glioblastoma 5,572
group 3 medulloblastoma 2,254
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung cancer 4,466
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
oligodendroglioma 2,849
pancreatic cancer 2,300
pediatric high grade glioma 2,712
permanent atrial fibrillation 44
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
primitive neuroectodermal tumor 3,031
psoriasis 6,685
rhinitis with controlled asthma 8
ulcerative colitis 2,087
uncontrolled asthma 67

Expression

Synonym

Accession Q16620 B1ANZ4 B4DFV9 Q16675 Q59GJ1 Q8WXJ5 Q8WXJ6 Q8WXJ7
Symbols TRKB
trk-B
GP145-TrkB

Gene

PDB

2MFQ   1HCF   1WWB   4ASZ   4AT3   4AT4   4AT5  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (223)

PMID Text
27048022 TrkB protein was mainly expressed in eutopic endometrium of proliferative phase with EMs than that in eutopic endometrium of secretory phase
26797418 Entrectinib inhibits growth of TrkB expressing neuroblastoma cells in vitro and in vivo, and that it enhances the efficacy of conventional chemotherapy in in vivo models.
26641254 Single-nucleotide polymorphisms rs1778929 and rs1187323 in the TrkB gene are significantly associated with post-stroke depression in the Chinese population.
26617738 results demonstrate the occurrence of ASIC2 and TrkB in the human intervertebral disc (IVD), and the increased expression of both in pathological IVD suggest their involvement in IVD degeneration
26515594 Data indicate the role of tropomyosin-related kinase-B (TrkB) in activation of the interleukin-6/Janus kinase 2/STAT3 transcription factor and PI3 kinase/c-AKT proto-oncogene protein pathway in breast cancer.
26481038 Excessive activation of TrkB was found to promote epilepsy in a transgenic mouse model.
26462037 Findings show no association of SNPs in NTRK2 and NGFR genes with completed suicide in Slovenian population.
26410934 The role of NTRK2 in in paranoid schizophrenia development in Russians.
26410307 soluble Abeta42 and BDNF, but not TrkB or soluble tau, correlate with dementia in the oldest-old
26122862 there are 15 positive studies among 30 studies regarding BDNF/TRKB/P75NTR polymorphisms antidepressant efficacy in depressed patients--{REVIEW}
More...

AA Sequence

MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE      1 - 70
IFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL     71 - 140
SELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEE    141 - 210
GKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVN    211 - 280
LTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDN    281 - 350
PTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST    351 - 420
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGPASVISNDDDSASPLHHISNGSNT    421 - 490
PSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNL    491 - 560
CPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLR    561 - 630
AHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRD    631 - 700
VYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGR    701 - 770
VLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG                      771 - 822
//

Text Mined References (265)

PMID Year Title
27048022 2016 Expression and significance of ER? and TrkB in endometriosis.
26797418 2016 Entrectinib is a potent inhibitor of Trk-driven neuroblastomas in a xenograft mouse model.
26641254 2015 Association between Single-Nucleotide Polymorphisms of the Tyrosine Kinase Receptor B (TrkB) and Post-Stroke Depression in China.
26617738 2015 Acid-sensing ion channel 2 (asic 2) and trkb interrelationships within the intervertebral disc.
26515594 2015 Induction of metastatic potential by TrkB via activation of IL6/JAK2/STAT3 and PI3K/AKT signaling in breast cancer.
26481038 2015 A Peptide Uncoupling BDNF Receptor TrkB from Phospholipase C?1 Prevents Epilepsy Induced by Status Epilepticus.
26462037 2015 Investigating the associations between polymorphisms in the NTRK2 and NGFR genes and completed suicide in the Slovenian sample.
26410934 2015 [The Role of Neurotrophins and Neurexins Genes in the Risk of Paranoid Schizophrenia in Russians and Tatars].
26410307 2015 Brain-derived neurotrophic factor and TrkB expression in the "oldest-old," the 90+ Study: correlation with cognitive status and levels of soluble amyloid-beta.
26122862 2015 BDNF/TRKB/P75NTR polymorphisms and their consequences on antidepressant efficacy in depressed patients.
More...