Property Summary

NCBI Gene PubMed Count 42
Grant Count 30
R01 Count 22
Funding $2,547,334.39
PubMed Score 234.60
PubTator Score 423.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.364 0.000

Gene RIF (31)

PMID Text
26621340 non-diabetic subjects who were overweight or obesity had significantly lower cardiotrophin-1 concentrations than those with normal weight, and both obesity and being overweight were inversely associated with cardiotrophin-1 levels.
26188636 This paper will review many aspects of CT-1 physiological role in several organs and discuss data for consideration in therapeutic approaches.
25919795 biliary epithelium-derived CT-1 may exert a profibrogenic potential in PCLD.
25689900 Data show that cardiotrophin-1 is positively related to brachial-ankle pulse-wave velocity (baPWV) independent of traditional cardiometabolic risk factors for arterial stiffness.
25025664 this study, even though preliminary and awaiting further confirmation by independent replication, provides first evidence that common genetic variation in CTF1 could contribute to insulin sensitivity in humans.
24401751 Study correlates CT-1 levels with ambulatory and central BP, as well as with pulse wave velocity in patients with essential hypertension.
24366078 exaggerated cardiomyocyte production of cardiotrophin-1 in response to increased left ventricular end-diastolic stress may contribute to fibrosis through stimulation of fibroblasts in heart failure of hypertensive origin.
24344663 CT-1 is differentially induced in the myocardium of infants with congenital cardiac defects depending on hypoxemia, and may mediate myocardial hypertrophy and dysfunction.
24054317 Subjects with impaired glucose tolerance (IGT) and newly diagnosed diabetes (NDD) have significantly higher CT-1 concentrations than those with normal glucose tolerance. IGT and NDD are positively associated with CT-1 concentrations.
23935888 CT-1 induces the proteolytic potential in human aortic endothelial cells by upregulating MMP-1 expression.
More...

AA Sequence

MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAG      1 - 70
LSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALL     71 - 140
AALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA             141 - 201
//

Text Mined References (43)

PMID Year Title
26621340 2015 Cardiotrophin-1 is inversely associated with obesity in non-diabetic individuals.
26188636 2015 Cardiotrophin-1: A multifaceted cytokine.
25919795 2015 A Potential Profibrogenic Role of Biliary Epithelium-Derived Cardiotrophin-1 in Pediatric Cholestatic Liver Disease.
25689900 2015 Cardiotrophin-1 is associated with increased risk of arterial stiffness.
25416956 2014 A proteome-scale map of the human interactome network.
25025664 2014 Common genetic variation in the human CTF1 locus, encoding cardiotrophin-1, determines insulin sensitivity.
24401751 2014 Association between cardiotrophin 1 levels and central blood pressure in untreated patients with essential hypertension.
24366078 2014 Association of cardiotrophin-1 with myocardial fibrosis in hypertensive patients with heart failure.
24344663 2014 Myocardial cardiotrophin-1 is differentially induced in congenital cardiac defects depending on hypoxemia.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...