1. Home
  2. Targets
  3. cell adhesion molecule
  4. Protein NKG7

Tdark Protein NKG7


 Comments

Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.72
PubTator Score 11.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.95074975179727E-25
non-small cell lung cancer 2798 8.38672976106922E-14
lung carcinoma 2844 1.87588315709599E-10
lung adenocarcinoma 2714 2.46252825201119E-8
osteosarcoma 7933 5.47421628262054E-5
cutaneous lupus erythematosus 1056 7.09184099654694E-5
tuberculosis 1563 0.00137655722798455
nephrosclerosis 329 0.00327392235019368
interstitial cystitis 2299 0.00375477444310146
pulmonary arterial hypertension 36 0.021427384250111
Disease Target Count Z-score Confidence
Lethal midline granuloma 6 3.841 1.9

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis 1.478 0.003
cutaneous lupus erythematosus 3.100 0.000
osteosarcoma -4.750 0.000
tuberculosis 1.100 0.001
non-small cell lung cancer -1.725 0.000
interstitial cystitis 1.500 0.004
lung adenocarcinoma -1.549 0.000
pulmonary arterial hypertension -1.300 0.021
lung carcinoma -1.300 0.000
psoriasis 1.200 0.000

Synonym

Accession Q16617
Symbols GIG1
GMP-17
p15-TIA-1

Gene

NKG7

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

 GO Component (1)

 Compartment GO Term (13)

 HCA RNA Cell Line (48)

See all...

Pathway (1)

 UniProt Keyword (7)

AA Sequence 

MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQTFSIMAVLWAL      1 - 70
VSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSA     71 - 140
ILLLCTGALSLGAHCGGPRPGYETL                                                 141 - 165
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8570616 1996 Characterization of GMP-17, a granule membrane protein that moves to the plasma membrane of natural killer cells following target cell recognition.
8458737 1993 Characterization of a novel gene (NKG7) on human chromosome 19 that is expressed in natural killer cells and T cells.
7510105 1994 Molecular cloning and characterization of G-CSF induced gene cDNA.