Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.72
PubTator Score 11.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis 1.478 0.003
cutaneous lupus erythematosus 3.100 0.000
osteosarcoma -4.750 0.000
tuberculosis 1.100 0.001
non-small cell lung cancer -1.725 0.000
interstitial cystitis 1.500 0.004
lung adenocarcinoma -1.549 0.000
pulmonary arterial hypertension -1.300 0.021
lung carcinoma -1.300 0.000
psoriasis 1.200 0.000

AA Sequence

MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQTFSIMAVLWAL      1 - 70
VSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQPPHPQIQTFFSWSFYLGWVSA     71 - 140
ILLLCTGALSLGAHCGGPRPGYETL                                                 141 - 165
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8570616 1996 Characterization of GMP-17, a granule membrane protein that moves to the plasma membrane of natural killer cells following target cell recognition.
8458737 1993 Characterization of a novel gene (NKG7) on human chromosome 19 that is expressed in natural killer cells and T cells.
7510105 1994 Molecular cloning and characterization of G-CSF induced gene cDNA.