Property Summary

NCBI Gene PubMed Count 37
PubMed Score 189.14
PubTator Score 142.36

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 2.400 5.6e-03
pituitary cancer 1.600 4.1e-02
psoriasis 1.200 4.4e-10

Gene RIF (24)

AA Sequence

MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEI      1 - 70
RHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILL     71 - 140
WRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCAITVGSLTFMELHCSLRGHPFLRRNSGC       141 - 207
//

Text Mined References (39)

PMID Year Title