Property Summary

NCBI Gene PubMed Count 33
Grant Count 78
R01 Count 55
Funding $12,222,266.91
PubMed Score 176.49
PubTator Score 142.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 2.400 0.006
pituitary cancer 1.600 0.041
psoriasis 1.200 0.000

Synonym

Accession Q16613 A0AVF2 J3KMZ5 Q562F4 Serotonin acetylase
Symbols DSPS
SNAT

Gene

PANTHER Protein Class (2)

Gene RIF (21)

PMID Text
21778461 There is dysregulation of the AANAT/ASMT/melatonin --> melatonin receptor axis in cholangiocarcinoma, which inhibited melatonin secretion and subsequently enhanced CCA growth.
21437622 The expression of AANAT in epithelial cells of striated ducts in human submandibular glands.
20586889 The functional expression of human SNA protein was closely associated with the elevated synthesis of N-acetylserotonin and melatonin in transgenic rice plants.
20459461 Identified 17 sequence changes in AANAT gene of patients with major depression. Show evidence of the association of genetic variability in the AANAT gene with susceptibility to major depression.
20459461 Observational study of gene-disease association. (HuGE Navigator)
20377855 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19184136 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEI      1 - 70
RHFLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILL     71 - 140
WRYLHHLGSQPAVRRAALMCEDALVPFYERFSFHAVGPCAITVGSLTFMELHCSLRGHPFLRRNSGC       141 - 207
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21778461 2011 Melatonin exerts by an autocrine loop antiproliferative effects in cholangiocarcinoma: its synthesis is reduced favoring cholangiocarcinoma growth.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21437622 2011 Expression and cellular localizaion of melatonin-synthesizing enzymes in rat and human salivary glands.
20586889 2010 Enhanced production of melatonin by ectopic overexpression of human serotonin N-acetyltransferase plays a role in cold resistance in transgenic rice seedlings.
20459461 2010 Resequencing and association analysis of arylalkylamine N-acetyltransferase (AANAT) gene and its contribution to major depression susceptibility.
20377855 2010 Mutation screening of melatonin-related genes in patients with autism spectrum disorders.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19184136 2009 Examination of association of genes in the serotonin system to autism.
More...