Property Summary

NCBI Gene PubMed Count 268
Grant Count 26
R01 Count 26
Funding $4,187,742.83
PubMed Score 156.30
PubTator Score 503.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 1.300 0.025
ovarian cancer 1.500 0.000
psoriasis 1.200 0.000

Gene RIF (196)

PMID Text
26743580 E6 proteins of human papillomavirus types 6 and 11 are able to protect keratinocytes from apoptosis via Bak degradation.
26668309 A Novel Naphthalimide Compound Restores p53 Function in Non-small Cell Lung Cancer by Reorganizing the Bak.Bcl-xl Complex and Triggering Transcriptional Regulation.
26610208 Findings argue for auto-activation of Bak in the absence of anti-apoptotic Bcl-2 proteins and provide evidence of profound differences in the activation of Bax and Bak.
26494789 high BAK expression correlates with sensitivity of clinical acute myelogenous leukemia to chemotherapy, whereas low BAK levels correlate with resistance and relapse
26417093 Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.
26406239 Report shows that high Bak expression is associated with the favorable overall survival rates of breast cancer patients.
26378049 LTX-315 kills cancer cells through Bax/Bak-regulated mitochondrial membrane permeabilization
26179084 Different selenium concentrations had varying effects on BAK1 and APAF1 levels. APAF1 may play an important role in the pathogenesis of KBD
26134559 Data show that mitochondrial X-linked inhibitor of apoptosis protein (XIAP) entry requires apoptosis regulatory proteins Bax or Bak through mitochondrial permeabilization and Smac/DIABLO protein degradation.
26030884 Puma is the major mediator of virus-induced Bax/Bak activation and mitochondrial membrane permeabilization induction.
More...

AA Sequence

MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSST      1 - 70
MGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLAL     71 - 140
HVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFK    141 - 210
S//

Text Mined References (273)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26743580 2016 E6 proteins from low-risk human papillomavirus types 6 and 11 are able to protect keratinocytes from apoptosis via Bak degradation.
26668309 2016 A Novel Naphthalimide Compound Restores p53 Function in Non-small Cell Lung Cancer by Reorganizing the Bak·Bcl-xl Complex and Triggering Transcriptional Regulation.
26610208 2015 In non-transformed cells Bak activates upon loss of anti-apoptotic Bcl-XL and Mcl-1 but in the absence of active BH3-only proteins.
26494789 2015 Constitutive BAK activation as a determinant of drug sensitivity in malignant lymphohematopoietic cells.
26417093 2015 Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.
26406239 2015 High Bak Expression Is Associated with a Favorable Prognosis in Breast Cancer and Sensitizes Breast Cancer Cells to Paclitaxel.
26378049 2015 The oncolytic peptide LTX-315 kills cancer cells through Bax/Bak-regulated mitochondrial membrane permeabilization.
26179084 2016 The Roles of the Interaction of BCL2-Antagonist/Killer 1, Apoptotic Peptidase Activating Factor 1 and Selenium in the Pathogenesis of Kashin-Beck Disease.
26134559 2015 Bax/Bak-dependent, Drp1-independent Targeting of X-linked Inhibitor of Apoptosis Protein (XIAP) into Inner Mitochondrial Compartments Counteracts Smac/DIABLO-dependent Effector Caspase Activation.
More...