Property Summary

NCBI Gene PubMed Count 284
PubMed Score 175.94
PubTator Score 503.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 1.300 2.5e-02
ovarian cancer 1.500 1.2e-09
psoriasis 1.200 3.0e-54

Gene RIF (207)

AA Sequence

MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSST      1 - 70
MGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLAL     71 - 140
HVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFK    141 - 210
S//

Text Mined References (289)

PMID Year Title