Property Summary

NCBI Gene PubMed Count 67
PubMed Score 134.10
PubTator Score 124.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Lipoid proteinosis 5 8.178 4.0
Disease Target Count Z-score Confidence
Doyne honeycomb retinal dystrophy 9 3.59 1.8

Expression

  Differential Expression (15)

Disease log2 FC p
Astrocytoma, Pilocytic 2.000 2.3e-06
atypical teratoid / rhabdoid tumor 1.100 4.4e-03
Breast cancer 2.200 1.5e-06
breast carcinoma 1.300 6.9e-11
cystic fibrosis 1.900 3.1e-03
Endometriosis 1.060 4.7e-02
esophageal adenocarcinoma -3.100 1.9e-02
gastric carcinoma 1.400 1.4e-02
glioblastoma 1.300 3.7e-03
interstitial lung disease 1.100 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.800 2.8e-03
lung adenocarcinoma 1.500 1.8e-03
malignant mesothelioma 1.300 2.1e-06
pancreatic cancer 1.700 6.9e-05
psoriasis -1.700 2.8e-04

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (50)

AA Sequence

MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFE      1 - 70
GQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHP     71 - 140
EPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETL    141 - 210
NFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQ    211 - 280
LRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCR    281 - 350
QGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPN    351 - 420
LMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLS    421 - 490
PGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE                        491 - 540
//

Text Mined References (70)

PMID Year Title