Property Summary

NCBI Gene PubMed Count 59
Grant Count 6
Funding $318,007
PubMed Score 127.65
PubTator Score 124.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
interstitial lung disease 1.100 0.016
malignant mesothelioma 1.300 0.000
esophageal adenocarcinoma -3.100 0.019
psoriasis -1.700 0.000
atypical teratoid / rhabdoid tumor 1.100 0.004
glioblastoma 1.300 0.004
intraductal papillary-mucinous neoplasm ... 1.800 0.003
pancreatic cancer 1.700 0.000
cystic fibrosis 1.900 0.003
pilocytic astrocytoma 2.000 0.000
lung adenocarcinoma 1.500 0.002
Endometriosis 1.060 0.047
breast carcinoma 1.300 0.000
Breast cancer 2.200 0.000
gastric carcinoma 1.400 0.014

Gene RIF (44)

PMID Text
26564090 Lipoid proteinosis is a rare autosomal recessive disorder caused by mutations in ECM1, encoding extracellular matrix protein 1, a glycoprotein expressed in many organs and which has important protein-protein interactions in tissue homeostasis
25824756 High extracellular matrix protein-1 expression is associated with the growth, metastasis and angiogenesis of laryngeal carcinoma
25812648 MMP-2 protein and ECM1 gene are useful preoperative markers for defining malignancy in suspicious thyroid nodules
25746001 association between beta-catenin and the MUC1 cytoplasmic tail was increased by ECM1
25529926 This large cohort revealed extensive phenotypic variability in individuals with the same mutation in ECM1.
25518807 Lipoidproteinosis results from a large homozygous deletion of ECM1 gene in a Chinese family.
25517360 Report a global loss of 5hmC identified three new genes (ECM1, ATF5, and EOMES) with potential anti-cancer functions that may promote the understanding of the molecular mechanisms of hepatocellular carcinoma development and progression.
25446258 ECM1 induced the expression of genes that promote the Warburg effect, such as glucose transporter 1 (GLUT1), lactate dehydrogenase A (LDHA), and hypoxia-inducible factor 1 alpha (HIF-1alpha).
24779890 High extracellular matrix protein 1 expression is correlated to carcinogenesis and lymphatic metastasis of gastric cancer
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
More...

AA Sequence

MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFE      1 - 70
GQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHP     71 - 140
EPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETL    141 - 210
NFLEIGYSRCCHCRSHTNRLECAKLVWEEAMSRFCEAEFSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQ    211 - 280
LRACPSHQPDISSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCR    281 - 350
QGNNHTCTWKAWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPN    351 - 420
LMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLS    421 - 490
PGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE                        491 - 540
//

Text Mined References (62)

PMID Year Title
26564090 2015 Lipoid proteinosis.
25824756 2015 Study on the correlation between extracellular matrix protein-1 and the growth, metastasis and angiogenesis of laryngeal carcinoma.
25812648 2015 Expression of ECM1 and MMP-2 in follicular thyroid lesions among Egyptians.
25746001 2015 ECM1 regulates tumor metastasis and CSC-like property through stabilization of ?-catenin.
25529926 2015 Lipoid proteinosis: phenotypic heterogeneity in Iranian families with c.507delT mutation in ECM1.
25518807 2015 Lipoid Proteinosis Resulting from a Large Homozygous Deletion Affecting Part of the ECM1 Gene and Adjacent Long Non-coding RNA.
25517360 2014 Integrated analyses of DNA methylation and hydroxymethylation reveal tumor suppressive roles of ECM1, ATF5, and EOMES in human hepatocellular carcinoma.
25446258 2015 ECM1 promotes the Warburg effect through EGF-mediated activation of PKM2.
24779890 2014 Extracellular matrix protein 1 is correlated to carcinogenesis and lymphatic metastasis of human gastric cancer.
24708644 2014 Treatment of lipoid proteinosis due to the p.C220G mutation in ECM1, a major allele in Chinese patients.
More...