Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00
PubTator Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Coronary heart disease 59

Gene RIF (3)

PMID Text
23036009 The risk for coronary artery disease in a Chinese Han population is not associated with single nucleotide polymorphisms in the SLC22A3-LPAL2-LPA gene cluster.
19198611 Identification of the SLC22A3-LPAL2-LPA gene cluster as a strong susceptibility locus for coronary artery disease.
19198611 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPND      1 - 70
GLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA             71 - 132
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23036009 2012 Lack of association between four SNPs in the SLC22A3-LPAL2-LPA gene cluster and coronary artery disease in a Chinese Han population: a case control study.
21900290 2012 Genetic variants, plasma lipoprotein(a) levels, and risk of cardiovascular morbidity and mortality among two prospective cohorts of type 2 diabetes.
21493818 2011 Genetic and clinical correlates of early-outgrowth colony-forming units.
19198611 2009 Genome-wide haplotype association study identifies the SLC22A3-LPAL2-LPA gene cluster as a risk locus for coronary artery disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8148351 1994 The human apolipoprotein(a)/plasminogen gene cluster contains a novel homologue transcribed in liver.
7749817 1995 Loss of a splice donor site at a 'skipped exon' in a gene homologous to apolipoprotein(a) leads to an mRNA encoding a protein consisting of a single kringle domain.
More...