Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MEHKEVVLLLLLFLKSAPTETGPSVQECYHSNGQSYRGTYFTTVTGRTCQAWSSMTPHQHSRTPEKYPND      1 - 70
GLISNYCRNPDCSAGPWCYTTDPNVRWEYCNLTRCSDDEGTVFVPLTVIPVPSLEDSFIQVA             71 - 132
//

Text Mined References (15)

PMID Year Title