Property Summary

Ligand Count 407
NCBI Gene PubMed Count 86
PubMed Score 177.65
PubTator Score 119.06

Knowledge Summary

Patent (9,007)

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 2.100 7.0e-05
astrocytic glioma 3.100 5.4e-04
Astrocytoma, Pilocytic 2.200 5.5e-07
atypical teratoid / rhabdoid tumor 2.500 3.3e-06
ependymoma 1.500 1.1e-05
glioblastoma 1.900 3.2e-06
interstitial cystitis 1.300 3.4e-02
intraductal papillary-mucinous adenoma (... -1.300 2.5e-03
intraductal papillary-mucinous carcinoma... -1.400 2.1e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.9e-02
lung adenocarcinoma -2.100 5.0e-12
lung cancer -3.200 5.6e-06
lung carcinoma -2.200 1.3e-08
medulloblastoma 1.300 1.2e-03
medulloblastoma, large-cell 2.100 6.0e-05
non-small cell lung cancer -1.891 5.8e-19
oligodendroglioma 2.200 3.8e-03
osteosarcoma 1.097 4.4e-02
ovarian cancer -1.600 4.7e-09
primitive neuroectodermal tumor 1.400 3.0e-03
psoriasis -1.300 3.4e-02
tuberculosis -1.500 3.4e-06
ulcerative colitis 1.500 3.5e-03

Protein-protein Interaction (3)

Gene RIF (59)

AA Sequence

MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWD      1 - 70
GWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALN     71 - 140
LFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPV    141 - 210
SCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYND    211 - 280
NCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFV    281 - 350
LIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS    351 - 420
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN                                 421 - 461
//

Text Mined References (88)

PMID Year Title