Property Summary

NCBI Gene PubMed Count 82
Grant Count 53
R01 Count 43
Funding $2,726,582.32
PubMed Score 170.17
PubTator Score 119.06

Knowledge Summary

Patent (9,007)

Expression

Synonym

Accession Q16602 A8K6G5 A8KAD3 Q53S02 Q53TS5 CGRP type 1 receptor
Symbols CRLR
CGRPR

Gene

PDB

4RWF   3AQF   3N7P   3N7R   3N7S   4RWG  

  TechDev Info (1)

Gene RIF (56)

PMID Text
25982113 Data suggest that ligand binding of a G protein-coupled receptor (GPCR) may inform drug development targeting calcitonin receptor-like receptor (CLR):receptor activity-modifying proteins RAMP1/2 complexes.
25591908 STC1 interferes with CALCRL signaling during osteoblastogenesis via adenylate cyclase inhibition.
24831942 the AM system is widely expressed in human thymus from newborns; both AM1 receptor components CLR and RAMP2, but not RAMP3, are not associated with the plasma membrane of TECs and thymocytes but are located intracellularly, notably in the nucleus
24199627 Data suggest isoforms of RAMP (receptor activity-modifying protein) modulate accessibility of peptides to residues situated on CALCRL N-terminal domain; RAMP3/RAMP2/RAMP1 appear to alter accessibility of specific residues at CALCRL-RAMP interface.
24169318 CRLR expression is upregulated in the fetal lung with increasing gestational age.
24047872 An alanine scan of residues 271-294 of CLR showed that the ability of CGRP to produce cAMP was impaired by point mutations at 13 residues; most of these also impaired the response to adrenomedullin (AM).
23969937 The G-protein-coupled receptor CLR is upregulated in an autocrine loop with adrenomedullin in clear cell renal cell carcinoma and associated with poor prognosis.
23797962 Two CALCRL variants were associated with risk for gestational diabetes.
22933837 The study implicates genetic variation at the CALCRL gene in the pathogenesis of primary angle closure glaucoma in an Australian Caucasian cohort.
22484227 CLR and RAMP1 co-localize in the enteric nervous system of the stomach, ileum and colon, and are in close proximity to their ligands CGRP and IMD
More...

AA Sequence

MEKKCTLNFLVLLPFFMILVTAELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWD      1 - 70
GWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTALN     71 - 140
LFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIHLTAVANNQALVATNPV    141 - 210
SCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYND    211 - 280
NCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFV    281 - 350
LIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSAS    351 - 420
YTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN                                 421 - 461
//

Text Mined References (85)

PMID Year Title
25982113 2015 Structural Basis for Receptor Activity-Modifying Protein-Dependent Selective Peptide Recognition by a G Protein-Coupled Receptor.
25591908 2015 STC1 interference on calcitonin family of receptors signaling during osteoblastogenesis via adenylate cyclase inhibition.
24831942 2014 Expression and distribution of the adrenomedullin system in newborn human thymus.
24199627 2014 Receptor activity-modifying protein-dependent effects of mutations in the calcitonin receptor-like receptor: implications for adrenomedullin and calcitonin gene-related peptide pharmacology.
24169318 2014 Adrenomedullin expression in the developing human fetal lung.
24047872 2013 The role of ECL2 in CGRP receptor activation: a combined modelling and experimental approach.
23969937 2013 The G-protein-coupled receptor CLR is upregulated in an autocrine loop with adrenomedullin in clear cell renal cell carcinoma and associated with poor prognosis.
23797962 2014 Adrenomedullin signaling pathway polymorphisms and adverse pregnancy outcomes.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
22933837 2012 A cross-ethnicity investigation of genes previously implicated in primary angle closure glaucoma.
More...