Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.77
PubTator Score 6.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
malignant mesothelioma 3232 2.8e-08
lung cancer 4740 4.8e-03
invasive ductal carcinoma 2951 7.4e-03
colon cancer 1478 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.8
Disease Target Count Z-score Confidence
Rabies 20 3.671 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.900 4.6e-02
invasive ductal carcinoma 1.300 7.4e-03
lung cancer 1.600 4.8e-03
malignant mesothelioma 4.600 2.8e-08

Gene RIF (7)

AA Sequence

MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTLQSGCFENIESETYLPLKVSS      1 - 70
QIDTQDSSVKFCKNEPQDHQESRRLFVMEESTERKVIKGESCSENLQVKLVSDGQELASPLLNGEATCQN     71 - 140
GQLKESLDPIDCNCKDIHGWKSQVVSCSQQRAHTEEKPCDHNNCGKILNTSPDGHPYEKIHTAEKQYECS    141 - 210
QCGKNFSQSSELLLHQRDHTEEKPYKCEQCGKGFTRSSSLLIHQAVHTDEKPYKCDKCGKGFTRSSSLLI    211 - 280
HHAVHTGEKPYKCDKCGKGFSQSSKLHIHQRVHTGEKPYECEECGMSFSQRSNLHIHQRVHTGERPYKCG    281 - 350
ECGKGFSQSSNLHIHRCIHTGEKPYQCYECGKGFSQSSDLRIHLRVHTGEKPYHCGKCGKGFSQSSKLLI    351 - 420
HQRVHTGEKPYECSKCGKGFSQSSNLHIHQRVHKKDPR                                    421 - 458
//

Text Mined References (19)

PMID Year Title