Property Summary

NCBI Gene PubMed Count 53
PubMed Score 223.13
PubTator Score 22.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
acute quadriplegic myopathy 1158 9.7e-07
Multiple myeloma 1332 6.6e-05
Pick disease 1894 1.8e-04
lung cancer 4740 3.8e-03
astrocytic glioma 2597 1.8e-02
oligodendroglioma 2850 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.887 1.9
Spinocerebellar ataxia type 7 13 3.69 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.037 9.7e-07
astrocytic glioma -1.100 1.8e-02
lung cancer 1.900 3.8e-03
Multiple myeloma 1.706 6.6e-05
oligodendroglioma -1.100 2.5e-02
Pick disease -1.200 1.8e-04

Gene RIF (17)

AA Sequence

MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADD      1 - 70
VRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSA     71 - 140
GRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQ    141 - 210
NVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL                    211 - 264
//

Text Mined References (59)

PMID Year Title