Property Summary

NCBI Gene PubMed Count 53
PubMed Score 215.00
PubTator Score 22.83

Knowledge Summary

Patent

No data available

Synonym

Accession Q16594 D3DWA3 Q5U0D1 Q9BTS1
Symbols TAF2G
TAFII31
TAFII32
MGC:5067
TAFII-31
TAFII-32
TAFIID32
STAF31/32

Gene

PANTHER Protein Class (1)

Gene RIF (17)

PMID Text
26282181 findings suggest that p53 sequesters TAF9 from GLI1, which may contribute to inhibition of GLI1 activity by p53
22696218 TFIID TAF6-TAF9 complex formation involves the HEAT repeat-containing C-terminal domain of TAF6 and is modulated by TAF5 protein.
19643037 Multiple hTAF(II)31-binding motifs in the intrinsically unfolded transcriptional activation domain of VP16.
19251649 TAF9 functionally supports EKLF activity by enhancing its ability to activate the beta-globin gene. TAF9 interacts with a conserved beta-globin downstream promoter element
17967894 suggest a novel STAF65gamma-dependent function of STAGA-type complexes in cell proliferation and transcription activation by MYC postloading of TFIID and RNA polymerase II that involves direct recruitment of core Mediator
15601843 histone fold domain mediated interaction enhances the DNA binding activity of each of the TAF6-TAF9 and TAF4b-TAF12 pairs and of a histone-like octamer complex composed of the four TAFs
15489227 IL-1-inducible phosphorylation of p65 NFkB is mediated by multiple protein kinases including IKKalpha, IKKbeta, IKKepsilon, TBK1, and an unknown kinase and couples p65 to TAFII31-mediated IL-8 transcription
12837753 TAF9 depletion severely disrupts TFIID, indicating that the observed ongoing transcription is initiated with at least partially TAF-free TATA-binding protein.
9054383 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
8849451 Interaction of TFIID with the HIV-1 LTR, and therefore presumably HIV-1 Tat protein, is primarily dependent on the LTR TATA element and may also be stabilized or regulated by flanking E box motifs and basic helix-loop-helix proteins such as AP-4 and E47
More...

AA Sequence

MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADD      1 - 70
VRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSA     71 - 140
GRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQ    141 - 210
NVLINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL                    211 - 264
//

Text Mined References (59)

PMID Year Title
26282181 2015 p53 modulates the activity of the GLI1 oncogene through interactions with the shared coactivator TAF9.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22696218 2012 TFIID TAF6-TAF9 complex formation involves the HEAT repeat-containing C-terminal domain of TAF6 and is modulated by TAF5 protein.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20186459 2010 Depletion of hCINAP by RNA interference causes defects in Cajal body formation, histone transcription, and cell viability.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19643037 2009 Multiple hTAF(II)31-binding motifs in the intrinsically unfolded transcriptional activation domain of VP16.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...