Property Summary

NCBI Gene PubMed Count 33
Grant Count 8
R01 Count 8
Funding $478,737
PubMed Score 47.64
PubTator Score 42.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
26573378 Upregulation of miR1246 mediated the malignant progression of colorectal cancer and is partly attributed to the downregulation of the expression of CycG2.
26149128 Neisseria meningitidis caused changes in the abundance of several cell cycle regulatory mRNAs, including the cell cycle inhibitors p21(WAF1/CIP1) and cyclin G2 in human brain microvascular endothelial cells.
25309979 miR-93-CCNG2 axis may be involved in Laryngeal squamous cell carcinoma proliferation and progression.
25122062 Data (from studies using BeWo cells, a choriocarcinoma cell line, as model of placentation) suggest that miR-378a-5p (microRNA 378a) inhibits cell differentiation in syncytiotrophoblasts, in part, by down-regulating CCNG2 (cyclin G2) expression.
25117811 miR-1246 expression was associated with chemoresistance and CSC-like properties via CCNG2, and could predict worse prognosis in pancreatic cancer patients
24708911 Data shows the human CCNG2 and CDK4 expression of visceral adipose tissue are inversely associated with glucose and insulin resistance.
24339739 Cyclin G2-involved invasion in vitro and in vivo.
24307622 The level of CCNG2 was correlated with T stages, lymph node metastasis, clinic stage, and histological grade (P < 0.05) in colorectal carcinoma.
24297335 CCNG2 may play important roles as a negative regulator to esophageal cancer cell by promoting degradation of CDK2.
24293374 CCNG2 expression decreased in prostate cancer and correlated significantly with lymph node metastasis, clinic stage, and Gleason score.
More...

AA Sequence

MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFF      1 - 70
GSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKR     71 - 140
MEKIISEKLHYELEATTALNFLHLYHTIILCHTSERKEILSLDKLEAQLKACNCRLIFSKAKPSVLALCL    141 - 210
LNLEVETLKSVELLEILLLVKKHSKINDTEFFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNL    211 - 280
HNSYYSVPELPTIPEGGCFDESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS          281 - 344
//

Text Mined References (34)

PMID Year Title
26573378 2016 MicroRNA-1246 promotes growth and metastasis of colorectal cancer cells involving CCNG2 reduction.
26149128 2016 Neisseria meningitidis causes cell cycle arrest of human brain microvascular endothelial cells at S phase via p21 and cyclin G2.
25309979 2015 MicroRNA-93 regulates cyclin G2 expression and plays an oncogenic role in laryngeal squamous cell carcinoma.
25122062 2014 MicroRNA-378a-5p targets cyclin G2 to inhibit fusion and differentiation in BeWo cells.
25117811 2014 MicroRNA-1246 expression associated with CCNG2-mediated chemoresistance and stemness in pancreatic cancer.
24708911 CCNG2 and CDK4 is associated with insulin resistance in adipose tissue.
24339739 2013 Cyclin G2 promotes hypoxia-driven local invasion of glioblastoma by orchestrating cytoskeletal dynamics.
24307622 2014 CCNG2 expression is downregulated in colorectal carcinoma and its clinical significance.
24297335 2014 Changes in the expression of cyclin G2 in esophageal cancer cell and its significance.
24293374 2014 Effect of cyclin G2 on proliferative ability of prostate cancer PC-3 cell.
More...