Property Summary

NCBI Gene PubMed Count 37
PubMed Score 50.36
PubTator Score 42.30

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (33)

Disease log2 FC p
acute quadriplegic myopathy 1.857 7.8e-06
adrenocortical carcinoma 1.096 7.6e-03
adult high grade glioma -1.700 7.5e-04
aldosterone-producing adenoma -1.475 2.1e-02
Amyotrophic lateral sclerosis 1.513 2.3e-08
astrocytoma -1.100 4.3e-03
Astrocytoma, Pilocytic -1.400 6.6e-05
atypical teratoid / rhabdoid tumor -1.100 1.3e-02
autosomal dominant Emery-Dreifuss muscul... 1.465 7.3e-04
Breast cancer -1.300 2.4e-05
dermatomyositis 1.300 6.5e-03
Duchenne muscular dystrophy 1.370 1.1e-08
ependymoma -1.100 3.7e-03
esophageal adenocarcinoma -1.500 3.4e-02
gastric cancer -1.200 1.3e-02
Gaucher disease type 3 -1.200 8.7e-03
glioblastoma -1.600 3.3e-09
group 3 medulloblastoma 2.100 4.3e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.9e-02
juvenile dermatomyositis 1.265 2.3e-11
lung cancer 1.100 2.5e-02
malignant mesothelioma -1.300 4.7e-06
medulloblastoma, large-cell 1.400 1.3e-02
osteosarcoma 1.023 3.1e-02
ovarian cancer -1.600 9.6e-06
pancreatic cancer -1.500 6.9e-03
pancreatic carcinoma -1.500 6.9e-03
pancreatic ductal adenocarcinoma liver m... 1.101 1.5e-02
primary Sjogren syndrome 1.200 6.4e-04
primitive neuroectodermal tumor -1.100 6.9e-03
sarcoidosis 1.200 1.2e-02
subependymal giant cell astrocytoma -1.361 1.8e-02
tuberculosis and treatment for 6 months 1.200 2.8e-04

Gene RIF (34)

AA Sequence

MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFF      1 - 70
GSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKR     71 - 140
MEKIISEKLHYELEATTALNFLHLYHTIILCHTSERKEILSLDKLEAQLKACNCRLIFSKAKPSVLALCL    141 - 210
LNLEVETLKSVELLEILLLVKKHSKINDTEFFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNL    211 - 280
HNSYYSVPELPTIPEGGCFDESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS          281 - 344
//

Text Mined References (38)

PMID Year Title