Property Summary

NCBI Gene PubMed Count 41
PubMed Score 188.18
PubTator Score 196.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.300 3.1e-02
lung adenocarcinoma -1.900 4.3e-09
non-small cell lung cancer -1.200 3.3e-19
psoriasis -1.700 1.0e-04

 GO Function (1)

Gene RIF (17)

AA Sequence

MAETLFWTPLLVVLLAGLGDTEAQQTTLHPLVGRVFVHTLDHETFLSLPEHVAVPPAVHITYHAHLQGHP      1 - 70
DLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLV     71 - 140
RSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCL    141 - 210
KMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTE    211 - 280
APDRDFLVDALVTLLVPLLVALLLTLLLAYVMCCRREGRLKRDLATSDIQMVHHCTIHGNTEELRQMAAS    281 - 350
REVPRPLSTLPMFNVHTGERLPPRVDSAQVPLILDQH                                     351 - 387
//

Text Mined References (42)

PMID Year Title