Property Summary

NCBI Gene PubMed Count 31
PubMed Score 853.74
PubTator Score 148.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
aldosterone-producing adenoma -1.284 2.0e-02
Astrocytoma, Pilocytic 1.200 7.3e-07
colon cancer -1.300 4.7e-02
ductal carcinoma in situ -1.300 3.0e-03
Gaucher disease type 1 -1.900 4.9e-03
glioblastoma 1.600 3.5e-03
hereditary spastic paraplegia -1.235 1.9e-02
invasive ductal carcinoma -2.000 1.1e-03
malignant mesothelioma -3.700 1.6e-09
osteosarcoma 2.317 8.2e-05
ovarian cancer -1.100 3.3e-03
primary pancreatic ductal adenocarcinoma 1.155 7.8e-03
psoriasis 1.300 1.2e-03
Rheumatoid arthritis 1.300 3.3e-02

Gene RIF (7)

AA Sequence

MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVII      1 - 70
LLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN     71 - 140
NQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLPSGVKSLNVQKASTERITS    141 - 210
NATSDLNIKVDGRAIVRGNEGVFIMGKTIEFHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSG    211 - 280
DWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH                                    281 - 318
//

Text Mined References (32)

PMID Year Title