Property Summary

NCBI Gene PubMed Count 56
Grant Count 11
R01 Count 5
Funding $497,760.18
PubMed Score 32.63
PubTator Score 33.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.010 0.000
acute quadriplegic myopathy 1.046 0.000
ovarian cancer -1.400 0.000

Gene RIF (13)

PMID Text
25885317 Ras induced RbAp46 expression increases invasion of bladder cancer cells.
25795299 the CRL4 complex containing RBBP7 (CRL4(RBBP7)) might regulate mitosis by promoting ubiquitin-dependent loading of newly synthesized CENP-A during the G1 phase of the cell cycle.
24116224 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A
22190034 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19655816 Both of RbAp46 mRNA and protein levels were upregulated significantly in NSCLC cancer tissues. Serum levels of RbAp46 were markedly higher in NSCLC patients than in healthy controls.
19454010 HIV-1 Vpr forms a complex by recruiting RbAp46, HAT1, ZIP/sZIP, and Cul4A
18577416 Data show that RbAp46 and RbAp48 interact with estrogen receptor (ER)alpha at endogenous, estrogen-responsive genes and alter expression of endogenous, ERalpha-activated and -repressed genes in MCF-7 breast cancer cells.
18571423 RbAp46 folds into a seven-bladed beta propeller structure and binds histone H4 in a groove formed between an N-terminal alpha helix and an extended loop inserted into blade six.
More...

AA Sequence

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTH      1 - 70
TSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIA     71 - 140
TKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGP    141 - 210
KEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF    211 - 280
NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG    281 - 350
EEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL    351 - 420
EGQGS                                                                     421 - 425
//

Text Mined References (69)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25885317 2015 Ras induces experimental lung metastasis through up-regulation of RbAp46 to suppress RECK promoter activity.
25795299 2015 CRL4(RBBP7) is required for efficient CENP-A deposition at centromeres.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25556658 2015 Dynamic phosphorylation of CENP-A at Ser68 orchestrates its cell-cycle-dependent deposition at centromeres.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23273982 2013 An H3K36 methylation-engaging Tudor motif of polycomb-like proteins mediates PRC2 complex targeting.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...