Property Summary

NCBI Gene PubMed Count 63
PubMed Score 33.24
PubTator Score 33.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
acute quadriplegic myopathy 1.046 5.1e-05
ovarian cancer -1.400 4.3e-04
Waldenstrons macroglobulinemia 1.010 4.1e-04

Gene RIF (18)

AA Sequence

MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTH      1 - 70
TSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIA     71 - 140
TKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGP    141 - 210
KEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSF    211 - 280
NPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIG    281 - 350
EEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL    351 - 420
EGQGS                                                                     421 - 425
//

Text Mined References (77)

PMID Year Title