Property Summary

Ligand Count 171
NCBI Gene PubMed Count 26
PubMed Score 507.17
PubTator Score 100.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Myasthenic Syndromes, Congenital 16 0.0 0.0
Disease Target Count P-value
psoriasis 6694 5.8e-10
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 25 0.0 4.0
Disease Target Count Z-score Confidence
Alzheimer's disease 658 4.42 2.2
Dementia 175 3.27 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.300 5.8e-10

Gene RIF (17)

AA Sequence

MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGGEG      1 - 70
PTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESEDVKIGVLFASKAILQLLVNP     71 - 140
LSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPER    141 - 210
SRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGT    211 - 280
PIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAA    281 - 350
RYPHLQWLYGALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV    351 - 420
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPP    421 - 490
QGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS                                491 - 532
//

Text Mined References (30)

PMID Year Title