Property Summary

NCBI Gene PubMed Count 25
Grant Count 124
R01 Count 66
Funding $16,095,553.5
PubMed Score 486.34
PubTator Score 100.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.300 0.000

Synonym

Accession Q16572 B2R7S1 VAChT
Symbols VACHT

Gene

Gene RIF (16)

PMID Text
24732660 PCMC expression of ADAM29, FLRT2, and SLC18A3 could be assessed as part of a routine screen to help identify individuals at risk of severe Obstructive sleep apnea in Asian populations
24316404 Expression of VAChT is increased in neuronal cell lines following upregulation of Lhx8.
23222296 Data indicate that siRNA-mediated attenuation of vesicular acetylcholine transporter (VAChT, SLC18A3) reversed the apoptotic activity of vesamicol.
22821666 alpha-Synuclein expression in axons to the distal gut correlates closely with expression of the cholinergic marker, VAChT.
21948486 Multiple abnormalities with intellectual and developmental disability result from recurrent deletions and reciprocal duplications of 10q11.21q11.23 including CHAT and SLC18A3.
21163949 overexpressed ChAT enhanced transcription of the CHT1 gene but not the VACHT gene
20831599 Mutations in the vesicular acetylcholine transporter demonstrate decreased affinity for acetylcholine and vesamicol.
20490865 The colocalisation of CHT1 immunoreactivity with VAChT immunoreactivity in cholinergic enteric nerves in the human bowel thus suggests that CHT1 represents another marker of cholinergic nerves.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19685929 Time-dependent dissociation of bound [3H]vesamicol is biphasic, but equilibrium saturation curves are not. The contrasting phasicity suggests that the pathway to and from the [3H]vesamicol binding site exists in open and at least partially closed states.
More...

AA Sequence

MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGGEG      1 - 70
PTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESEDVKIGVLFASKAILQLLVNP     71 - 140
LSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPER    141 - 210
SRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGT    211 - 280
PIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAA    281 - 350
RYPHLQWLYGALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV    351 - 420
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPP    421 - 490
QGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS                                491 - 532
//

Text Mined References (28)

PMID Year Title
24732660 Gene expression profiles in peripheral blood mononuclear cells of Asian obstructive sleep apnea patients.
24316404 2014 Upregulation of Lhx8 increase VAChT expression and ACh release in neuronal cell line SHSY5Y.
23222296 2013 Inhibition of cholinergic signaling causes apoptosis in human bronchioalveolar carcinoma.
22821666 2013 Selective expression of ?-synuclein-immunoreactivity in vesicular acetylcholine transporter-immunoreactive axons in the guinea pig rectum and human colon.
21948486 2012 Recurrent deletions and reciprocal duplications of 10q11.21q11.23 including CHAT and SLC18A3 are likely mediated by complex low-copy repeats.
21163949 2011 Nuclear choline acetyltransferase activates transcription of a high-affinity choline transporter.
20831599 2010 Search for the acetylcholine and vesamicol binding sites in vesicular acetylcholine transporter: the region around the lumenal end of the transport channel.
20490865 2010 Immunoreactivity for high-affinity choline transporter colocalises with VAChT in human enteric nervous system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19685929 2009 Multiple protonation states of vesicular acetylcholine transporter detected by binding of [3H]vesamicol.
More...