Property Summary

NCBI Gene PubMed Count 128
PubMed Score 646.97
PubTator Score 409.05

Knowledge Summary

Patent (43,303)

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.393 7.2e-08
Astrocytoma, Pilocytic -1.100 1.1e-02
atypical teratoid / rhabdoid tumor -2.200 1.9e-07
autosomal dominant Emery-Dreifuss muscul... 1.006 3.2e-03
Breast cancer -2.800 4.5e-02
breast carcinoma -1.500 1.7e-12
cystic fibrosis 1.100 5.3e-03
Duchenne muscular dystrophy 1.143 4.8e-07
ductal carcinoma in situ -1.300 6.0e-03
glioblastoma -1.200 1.2e-03
interstitial cystitis 2.300 6.5e-05
intraductal papillary-mucinous adenoma (... -3.500 8.7e-06
intraductal papillary-mucinous carcinoma... -3.600 1.0e-05
intraductal papillary-mucinous neoplasm ... -3.500 4.7e-04
invasive ductal carcinoma -3.300 3.3e-04
lung adenocarcinoma -1.683 7.2e-11
non-small cell lung cancer -3.391 4.0e-20
osteosarcoma -2.455 2.7e-02
pituitary cancer 1.200 1.1e-02
primary Sjogren syndrome 1.500 4.6e-04
psoriasis -1.100 7.9e-05
pterygium 1.400 1.3e-02
subependymal giant cell astrocytoma -1.810 4.4e-02
ulcerative colitis 1.800 8.5e-05

Protein-protein Interaction (1)

Gene RIF (109)

AA Sequence

MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSV      1 - 70
LGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSA     71 - 140
FAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATH    141 - 210
TVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ    211 - 280
ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS                  281 - 336
//

Text Mined References (134)

PMID Year Title