Property Summary

NCBI Gene PubMed Count 122
Grant Count 213
R01 Count 86
Funding $38,352,489.04
PubMed Score 621.64
PubTator Score 409.05

Knowledge Summary

Patent (43,303)

Expression

Synonym

Accession Q16570 A8YPG5 O75898 Q16300 Q8WWE3 Q9UJP0 Q9UKZ5 Q9UKZ6 Q9UQE1
Symbols FY
Dfy
GPD
DARC
GpFy
CCBP1
CD234
WBCQ1

Gene

PDB

4NUU   4NUV  

Gene RIF (103)

PMID Text
26320997 DARC is required for Staphylococcus aureus-mediated lysis of human erythrocytes, and DARC overexpression is sufficient to render cells susceptible to toxin-mediated lysis.
26096170 We showed that DARC expression is down-regulated in CRC and associated with clinical pathological features and MVD of CRC. DARC might be involved in tumorigenesis, progression, angiogenesis, and metastasis of CRC.
26045366 DARC levels are elevated in human keloid fibroblasts and might inhibit the secretion of CCL2.
25817587 the odds for neutropenia in the ACKR1-null (FY-) individuals were 46-fold higher than for FY+ individuals (Crude odds ratio = 46, 95% confidence interval = 8.03-263, P < 0.001)
25647274 study demonstrates the association of SNP rs12075 from DARC gene with the levels of serum IL8
25582271 Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients.
24981451 DARC facilitates CXCL1 inhibition of airway smooth muscle cell migration via modulation of the ERK-1/2 MAP kinase signaling pathway.
24929836 The majority of our population is heterozygous for Duffy antigens a and b.
24845979 Duffy blood group
24710306 DARC polymorphisms may influence the naturally acquired inhibitory anti-Duffy binding protein II immunity
More...

AA Sequence

MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSV      1 - 70
LGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSA     71 - 140
FAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATH    141 - 210
TVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ    211 - 280
ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS                  281 - 336
//

Text Mined References (128)

PMID Year Title
26320997 2015 Staphylococcus aureus Targets the Duffy Antigen Receptor for Chemokines (DARC) to Lyse Erythrocytes.
26096170 2015 Expression of Duffy antigen receptor for chemokines (DARC) is down-regulated in colorectal cancer.
26045366 2015 The role of Duffy antigen receptor for chemokines in keloids.
25900316 2015 Duffy blood group phenotype-genotype correlations using high-resolution melting analysis PCR and microarray reveal complex cases including a new null FY*A allele: the role for sequencing in genotyping algorithms.
25817587 2015 Correlation between 'ACKR1/DARC null' polymorphism and benign neutropenia in Yemenite Jews.
25647274 2015 Duffy antigen receptor genetic variant and the association with Interleukin 8 levels.
25582271 2015 Erythrocyte genotyping for transfusion-dependent patients at the Azienda Universitaria Policlinico of Naples.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24981451 2014 CXCL1 inhibits airway smooth muscle cell migration through the decoy receptor Duffy antigen receptor for chemokines.
24929836 2014 Frequencies of Duffy blood group alleles in Northern Pakistani donors.
More...