Property Summary

NCBI Gene PubMed Count 67
Grant Count 418
R01 Count 161
Funding $121,399,561.79
PubMed Score 2147.17
PubTator Score 383.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.500 0.004
ependymoma -1.600 0.004
oligodendroglioma -1.500 0.005
glioblastoma -1.600 0.000
group 4 medulloblastoma -1.800 0.001
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.400 0.023
primitive neuroectodermal tumor -1.300 0.013
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -1.700 0.000
lung carcinoma 2.400 0.000

Synonym

Accession Q16568 Q6FG92
Symbols CART

Gene

PDB

1HY9  

Gene RIF (59)

PMID Text
26730935 In samples from patients undergoing IVF, there is a significant positive correlation between patient BMI, CART mRNA expression in granulosa cells, and CART peptide levels in follicular fluid.
25871004 polymorphisms in the gene may be useful in identifying women at risk for osteoporosis.
25219614 In schizophrenia patients on clozapine monotherapy, CART levels did not correlate with age, weight, BMI, abdominal, waist and hip circumferences, WHR, blood pressure, clozapine dose or treatment duration, body composition, or markers of insulin resistance
25084101 Colocalization experiments provided evidence for the presence of cocaine- and amphetamine-regulated transcript (CART) in KP-immunoreactive (IR) and perikarya and in KP-IR and NKB-IR axon varicosities.
24995854 Lower CART levels pose a risk for developing polycystic ovary syndrome.
24564533 CART SNPs (rs10515115, rs3763153, rs3857384, rs11575893, rs16871471) were not associated with antipsychotic-induced weight gain in schizophrenia patients.
23277430 CART is expressed in nerve fibers and co-localizes with other neuronal factors in the circular muscle layer of human descending colon
23086924 Ischemia insult triggered by oxygen-glucose deprivation (OGD) enhances NRSF mRNA levels and then NRSF antagonizes the CREB signaling on CART activation, leading to augmented cell death.
23034261 a detailed description of the CART distribution pattern within the human alimentary tract.
22553341 Expression of CART in small bowel carcinoid tumors is associated with worse survival.
More...

AA Sequence

MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVP      1 - 70
IYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL                             71 - 116
//

Text Mined References (67)

PMID Year Title
26730935 2016 Leptin-Induced CART (Cocaine- and Amphetamine-Regulated Transcript) Is a Novel Intraovarian Mediator of Obesity-Related Infertility in Females.
25871004 2015 Polymorphisms in neuropeptide genes and bone mineral density in Korean postmenopausal women.
25352770 2014 CART in the regulation of appetite and energy homeostasis.
25219614 2014 Blood serum levels of CART peptide in patients with schizophrenia on clozapine monotherapy.
25084101 2014 Colocalization of cocaine- and amphetamine-regulated transcript with kisspeptin and neurokinin B in the human infundibular region.
24995854 2014 Lower cocaine- and amphetamine-regulated transcript levels pose a risk for developing PCOS.
24564533 2014 Investigation of melanocortin system gene variants in antipsychotic-induced weight gain.
23646285 2013 Genome-wide association study of HLA-DQB1*06:02 negative essential hypersomnia.
23277430 2013 Immunohistochemical distribution of cocaine- and amphetamine-regulated transcript peptide - like immunoreactive (CART-LI) nerve fibers and various degree of co-localization with other neuronal factors in the circular muscle layer of human descending colon.
23086924 2012 Neuron-restrictive silencer factor (NRSF) represses cocaine- and amphetamine-regulated transcript (CART) transcription and antagonizes cAMP-response element-binding protein signaling through a dual NRSE mechanism.
More...