Property Summary

NCBI Gene PubMed Count 68
PubMed Score 2625.78
PubTator Score 383.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.600 2.8e-03
astrocytic glioma -1.500 3.7e-03
Astrocytoma, Pilocytic -1.700 3.0e-06
atypical teratoid / rhabdoid tumor -1.600 5.6e-06
ependymoma -1.600 3.7e-03
glioblastoma -1.500 2.2e-08
group 4 medulloblastoma -1.800 8.1e-04
lung carcinoma 2.400 2.9e-17
medulloblastoma, large-cell -1.400 2.3e-02
oligodendroglioma -1.500 4.6e-03
primitive neuroectodermal tumor -1.300 1.3e-02

Gene RIF (60)

AA Sequence

MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVP      1 - 70
IYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL                             71 - 116
//

Text Mined References (68)

PMID Year Title