Property Summary

NCBI Gene PubMed Count 70
Grant Count 389
R01 Count 272
Funding $33,677,504.66
PubMed Score 141.59
PubTator Score 120.02

Knowledge Summary

Patent (14,979)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.600 0.001
posterior fossa group A ependymoma -4.500 0.000
oligodendroglioma -1.700 0.017
glioblastoma -4.600 0.000
osteosarcoma -1.620 0.019
medulloblastoma -2.700 0.000
cystic fibrosis 2.980 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -2.800 0.000
pediatric high grade glioma -4.000 0.000
pilocytic astrocytoma -4.000 0.000
sarcoidosis -1.400 0.000
subependymal giant cell astrocytoma -5.126 0.005
Pick disease -1.500 0.007

Synonym

Accession Q16566 D3DSZ7 CaMK IV
Symbols caMK
CaMK IV
CaMK-GR

Gene

PDB

2W4O  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (33)

PMID Text
26909912 The T-allele of rs10491334 in CAMK4 was associated with hypertension in the Uygur group.
25446257 Expression of CaMKIV inhibits autophosphorylation and activation of CaMKII, and elicits G0/G1cell cycle arrest,impairing cell proliferation.
24667640 CaMK4-dependent activation of AKT/mTOR and CREM-alpha underlies autoimmunity-associated Th17 imbalance.
24442360 An imbalance of specific isoforms of CYFIP1, an FMRP interaction partner, and CAMK4, a transcriptional regulator of the FMRP gene, modulates risk for autism spectrum disorders.
23103515 Phosphorylated Notch1-IC by CaMKIV increases Notch1-IC stability, which enhances osteoclast differentiation.
23049845 CaMK4 regulates beta-cell proliferation and apoptosis in a CREB-dependent manner and CaMK4-induced IRS-2 expression is important in these processes
22897820 study suggests that the mutations in CAMK4 may lead to abnormal semen parameters
21612516 Prolongevity genes are activated by CAMKIV, the levels of which are influenced by rs10491334, a single-nucleotide polymorphism associated with human longevity.
21514275 The regulation of RORalpha activity by PKA as well as CaMK-IV provides a new link in the signalling network that regulates metabolic processes such as glycogen and lipid metabolism.
20677014 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQK      1 - 70
PYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERD     71 - 140
AADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAP    141 - 210
EILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKL    211 - 280
IVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQ    281 - 350
ESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA    351 - 420
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY                     421 - 473
//

Text Mined References (82)

PMID Year Title
26909912 2016 CAMK4 gene variation is associated with hypertension in a Uygur population.
25446257 2015 A novel crosstalk between calcium/calmodulin kinases II and IV regulates cell proliferation in myeloid leukemia cells.
25226531 2014 Common variation near ROBO2 is associated with expressive vocabulary in infancy.
24667640 2014 CaMK4-dependent activation of AKT/mTOR and CREM-? underlies autoimmunity-associated Th17 imbalance.
24442360 2014 Common variants in genes of the postsynaptic FMRP signalling pathway are risk factors for autism spectrum disorders.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
More...