Property Summary

NCBI Gene PubMed Count 73
PubMed Score 151.12
PubTator Score 120.02

Knowledge Summary

Patent (14,979)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.400 5.3e-03
astrocytic glioma -2.600 1.4e-03
Astrocytoma, Pilocytic -1.400 7.3e-05
atypical teratoid / rhabdoid tumor -1.200 1.8e-04
cystic fibrosis 1.544 2.1e-04
ependymoma -1.100 2.1e-02
glioblastoma -1.300 6.6e-07
group 3 medulloblastoma -2.100 1.3e-02
medulloblastoma, large-cell -1.100 1.8e-03
oligodendroglioma -1.700 1.7e-02
osteosarcoma -1.620 1.9e-02
Pick disease -1.500 7.3e-03
primitive neuroectodermal tumor -1.300 2.7e-04
sarcoidosis -1.100 1.3e-05
subependymal giant cell astrocytoma -5.126 5.0e-03

Protein-protein Interaction (6)

Gene RIF (36)

AA Sequence

MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIVYRCKQKGTQK      1 - 70
PYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGYYSERD     71 - 140
AADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMKTVCGTPGYCAP    141 - 210
EILRGCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKL    211 - 280
IVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQ    281 - 350
ESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA    351 - 420
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY                     421 - 473
//

Text Mined References (85)

PMID Year Title