Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.85
PubTator Score 9.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
dermatomyositis -1.500 2.1e-03
Down syndrome 1.800 3.2e-04
ependymoma 1.900 2.5e-10
esophageal adenocarcinoma -1.300 4.3e-02
glioblastoma 1.900 2.0e-02
group 4 medulloblastoma -1.100 1.7e-03
hereditary spastic paraplegia -1.076 4.4e-03
osteosarcoma 1.566 2.2e-04
ovarian cancer -1.200 4.6e-04
pediatric high grade glioma 1.400 4.4e-04
progressive supranuclear palsy -1.200 8.5e-03

 GO Function (1)

Gene RIF (1)

AA Sequence

MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEIQVNCPPAVTE      1 - 70
NKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVTFAVFVFLYCIAALLLYVGYT     71 - 140
SLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKIATGHNIIDELPPCKKKAVLCYFGSVTSMGS    141 - 210
LNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSAPHSQGGIPPPTGI                         211 - 259
//

Text Mined References (20)

PMID Year Title