Property Summary

NCBI Gene PubMed Count 17
Grant Count 4
R01 Count 4
Funding $182,441.17
PubMed Score 16.94
PubTator Score 9.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
esophageal adenocarcinoma -1.300 0.043
osteosarcoma 1.566 0.000
ependymoma 1.900 0.000
glioblastoma 1.900 0.020
hereditary spastic paraplegia -1.076 0.004
pediatric high grade glioma 1.400 0.000
group 4 medulloblastoma -1.100 0.002
progressive supranuclear palsy -1.200 0.009
ovarian cancer -1.200 0.000
Down syndrome 1.800 0.000
dermatomyositis -1.500 0.002

 GO Function (1)

Gene RIF (1)

PMID Text
18720419 A role is found for synaptophysin I in the enduring neuroplasticity in the prefrontal cortical glutamate circuitry that is associated with ethanol dependence.

AA Sequence

MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEIQVNCPPAVTE      1 - 70
NKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVTFAVFVFLYCIAALLLYVGYT     71 - 140
SLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKIATGHNIIDELPPCKKKAVLCYFGSVTSMGS    141 - 210
LNVSVIFGFLNMILWGGNAWFVYKETSLHSPSNTSAPHSQGGIPPPTGI                         211 - 259
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18720419 2008 Elevated synaptophysin I in the prefrontal cortex of human chronic alcoholics.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...