Property Summary

NCBI Gene PubMed Count 9
Grant Count 31
R01 Count 15
Funding $5,119,267.83
PubMed Score 0.33
PubTator Score 5.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
21586597 An Fc-fusion protein of 35kDa with a modified human immunoglobulin IgG1 Fc domain is capable of inhibiting CC chemokine-induced calcium flux, chemotaxis, and beta-arrestin recruitment in primary macrophages and transfected cells.
19565553 Anti-U11/U12 RNP antibodies are present in the sera of approximately 3% of patients with systemic sclerosis and are a marker for lung fibrosis, which is often severe.

AA Sequence

MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEV      1 - 70
FSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRL     71 - 140
GGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDRGREKR    141 - 210
WQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK                                      211 - 246
//

Text Mined References (11)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
21586597 2011 Site-directed mutagenesis of the CC chemokine binding protein 35K-Fc reveals residues essential for activity and mutations that increase the potency of CC chemokine blockade.
19565553 2009 Anti-U11/U12 RNP antibodies in systemic sclerosis: a new serologic marker associated with pulmonary fibrosis.
18559850 2008 Minor spliceosome components are predominantly localized in the nucleus.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146077 2004 The human 18S U11/U12 snRNP contains a set of novel proteins not found in the U2-dependent spliceosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10520751 1998 Cloning and characterization of a family of cDNAs from human histiocyte macrophage cells encoding an arginine-rich basic protein related to the 70 kD U1-snRNP splicing factor.
More...