Property Summary

NCBI Gene PubMed Count 58
Grant Count 18
R01 Count 11
Funding $1,776,284.33
PubMed Score 81.96
PubTator Score 1863.79

Knowledge Summary

Patent (1,796)

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease 1.200 0.012
glioblastoma 1.900 0.000
medulloblastoma, large-cell 1.100 0.000
colon cancer -2.400 0.000
adult high grade glioma 1.400 0.001
posterior fossa group B ependymoma 1.200 0.000
non-inflammatory breast cancer -3.100 0.000
breast carcinoma -1.600 0.000
ovarian cancer 1.800 0.000

Gene RIF (47)

PMID Text
25825713 Data show that two lysine residues that are unique to the N terminus of calcium-activated potassium channel subunit beta-1 were identified to be sufficient for voltage-sensor modulation.
25576871 To determine the relationship between atherosclerosis and KCNMB1, we studied some atherogenic factors affecting vascular tone. Blood of atherosclerotic patients shows increased concentration of 7-ketocholesterol, possibly a harmful lipid to blood vessels.
25275635 The study demonstrates that both transmembrane domains of BKbeta1 are required to provide the characteristic ion current phenotype of beta1-containing BK channels.
24569989 N-terminal isoforms of the large-conductance Ca(2)-activated K channel are differentially modulated by the auxiliary beta1-subunit.
24476761 Bisphenol A activates BK alpha via an extracellular site and that Bisphenol A-sensitivity is increased by the beta1 subunit.
23825428 In large-conductance calcium-dependent potassium channels, beta1 and beta2 subunits alter the voltage sensing domain-cytosolic domain interface.
23255603 The results indicate that the beta1-subunit can form a tripartite complex with TP and MaxiKalpha, has the ability to associate with each protein independently.
22114151 HIF-1alpha increases KCNMB1 expression in response to hypoxia in human pulmonary artery smooth muscle cells by binding to two hypoxia response elements located at -3,540 to -3,311 of the KCNMB1 promoter
21413024 Cloned BK(Ca) channel directly regulated apoptosis and proliferation of HEK293 cell under hyperglycemia condition.
20966391 downregulation of vascular BK-beta(1) expression in diabetes and in high-glucose culture conditions was associated with FOXO-3a/FBXO-dependent increase in BK-beta(1) degradation.
More...

AA Sequence

MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKK      1 - 70
VPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPR     71 - 140
GNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK                       141 - 191
//

Text Mined References (59)

PMID Year Title
25825713 2015 Molecular mechanism underlying ?1 regulation in voltage- and calcium-activated potassium (BK) channels.
25825171 2015 Two distinct effects of PIP2 underlie auxiliary subunit-dependent modulation of Slo1 BK channels.
25576871 2015 7-Ketocholesterol induces the reduction of KCNMB1 in atherosclerotic blood vessels.
25275635 2014 Both transmembrane domains of BK ?1 subunits are essential to confer the normal phenotype of ?1-containing BK channels.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24569989 2014 N-terminal isoforms of the large-conductance Ca²?-activated K? channel are differentially modulated by the auxiliary ?1-subunit.
24476761 2014 Bisphenol A activates BK channels through effects on ? and ?1 subunits.
23825428 2013 The interface between membrane-spanning and cytosolic domains in Ca²+-dependent K+ channels is involved in ? subunit modulation of gating.
23255603 2013 The ?1-subunit of the MaxiK channel associates with the thromboxane A2 receptor and reduces thromboxane A2 functional effects.
22114151 2012 Hypoxia-inducible factor-1? regulates KCNMB1 expression in human pulmonary artery smooth muscle cells.
More...