Property Summary

NCBI Gene PubMed Count 58
PubMed Score 81.96
PubTator Score 1863.79

Knowledge Summary

Patent (1,796)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 2.90186426966668E-26
ovarian cancer 8492 2.51599510797745E-11
non-inflammatory breast cancer 208 1.8232870027376E-6
colon cancer 1475 3.74847516206881E-6
posterior fossa group B ependymoma 1530 1.43897496305087E-4
medulloblastoma, large-cell 6234 1.50079674534182E-4
glioblastoma 5572 3.07751493691143E-4
adult high grade glioma 2148 8.28184973896282E-4
interstitial lung disease 292 0.0115898907666346
Disease Target Count Z-score Confidence
Hypertension 293 3.66 1.8

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease 1.200 0.012
glioblastoma 1.900 0.000
medulloblastoma, large-cell 1.100 0.000
colon cancer -2.400 0.000
adult high grade glioma 1.400 0.001
posterior fossa group B ependymoma 1.200 0.000
non-inflammatory breast cancer -3.100 0.000
breast carcinoma -1.600 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q16558 O00707 O00708 P78475 Q53YR0 Q8TAX3 Q93005
Symbols hbeta1
BKbeta1
SLO-BETA
hslo-beta
K(VCA)beta
slo-beta-1
k(VCA)beta-1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG

Gene RIF (47)

PMID Text
25825713 Data show that two lysine residues that are unique to the N terminus of calcium-activated potassium channel subunit beta-1 were identified to be sufficient for voltage-sensor modulation.
25576871 To determine the relationship between atherosclerosis and KCNMB1, we studied some atherogenic factors affecting vascular tone. Blood of atherosclerotic patients shows increased concentration of 7-ketocholesterol, possibly a harmful lipid to blood vessels.
25275635 The study demonstrates that both transmembrane domains of BKbeta1 are required to provide the characteristic ion current phenotype of beta1-containing BK channels.
24569989 N-terminal isoforms of the large-conductance Ca(2)-activated K channel are differentially modulated by the auxiliary beta1-subunit.
24476761 Bisphenol A activates BK alpha via an extracellular site and that Bisphenol A-sensitivity is increased by the beta1 subunit.
23825428 In large-conductance calcium-dependent potassium channels, beta1 and beta2 subunits alter the voltage sensing domain-cytosolic domain interface.
23255603 The results indicate that the beta1-subunit can form a tripartite complex with TP and MaxiKalpha, has the ability to associate with each protein independently.
22114151 HIF-1alpha increases KCNMB1 expression in response to hypoxia in human pulmonary artery smooth muscle cells by binding to two hypoxia response elements located at -3,540 to -3,311 of the KCNMB1 promoter
21413024 Cloned BK(Ca) channel directly regulated apoptosis and proliferation of HEK293 cell under hyperglycemia condition.
20966391 downregulation of vascular BK-beta(1) expression in diabetes and in high-glucose culture conditions was associated with FOXO-3a/FBXO-dependent increase in BK-beta(1) degradation.
More...

AA Sequence

MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKK      1 - 70
VPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPR     71 - 140
GNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK                       141 - 191
//

Text Mined References (59)

PMID Year Title
25825713 2015 Molecular mechanism underlying ?1 regulation in voltage- and calcium-activated potassium (BK) channels.
25825171 2015 Two distinct effects of PIP2 underlie auxiliary subunit-dependent modulation of Slo1 BK channels.
25576871 2015 7-Ketocholesterol induces the reduction of KCNMB1 in atherosclerotic blood vessels.
25275635 2014 Both transmembrane domains of BK ?1 subunits are essential to confer the normal phenotype of ?1-containing BK channels.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24569989 2014 N-terminal isoforms of the large-conductance Ca²?-activated K? channel are differentially modulated by the auxiliary ?1-subunit.
24476761 2014 Bisphenol A activates BK channels through effects on ? and ?1 subunits.
23825428 2013 The interface between membrane-spanning and cytosolic domains in Ca²+-dependent K+ channels is involved in ? subunit modulation of gating.
23255603 2013 The ?1-subunit of the MaxiK channel associates with the thromboxane A2 receptor and reduces thromboxane A2 functional effects.
22114151 2012 Hypoxia-inducible factor-1? regulates KCNMB1 expression in human pulmonary artery smooth muscle cells.
More...