Property Summary

NCBI Gene PubMed Count 61
PubMed Score 92.17
PubTator Score 1863.79

Knowledge Summary

Patent (1,796)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.400 8.3e-04
Breast cancer 2.000 1.8e-02
breast carcinoma -1.600 2.9e-26
colon cancer -1.700 2.8e-02
glioblastoma 1.900 3.1e-04
interstitial lung disease 1.200 1.2e-02
medulloblastoma, large-cell 1.100 1.5e-04
ovarian cancer 1.800 2.5e-11
posterior fossa group B ependymoma 1.200 1.4e-04

Gene RIF (50)

AA Sequence

MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKK      1 - 70
VPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPR     71 - 140
GNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK                       141 - 191
//

Text Mined References (62)

PMID Year Title