Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.96
PubTator Score 11.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
cystic fibrosis 1696 8.1e-06
malignant mesothelioma 3232 1.9e-05
psoriasis 6694 3.2e-03
Breast cancer 3578 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.200 1.8e-02
cystic fibrosis 1.419 8.1e-06
malignant mesothelioma 1.600 1.9e-05
psoriasis 1.100 3.2e-03

AA Sequence

MGPLSAPPCTQRITWKGLLLTALLLNFWNLPTTAQVTIEAEPTKVSKGKDVLLLVHNLPQNLAGYIWYKG      1 - 70
QMKDLYHYITSYVVDGQIIIYGPAYSGRETVYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTF     71 - 140
TLYLETPKPSISSSNLYPREDMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLQLSKNKRTLFLFGVTKY    141 - 210
TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSL    211 - 280
PVSPRVKRPIENRILILPSVTRNETGPYQCEIQDRYGGIRSYPVTLNVLYGPDLPRIYPSFTYYHSGENL    281 - 350
YLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSATGMESSKSMTVKVSAPSGTG    351 - 420
HLPGLNPL                                                                  421 - 428
//

Text Mined References (14)

PMID Year Title