Property Summary

NCBI Gene PubMed Count 79
Grant Count 30
R01 Count 10
Funding $2,912,346.26
PubMed Score 212.54
PubTator Score 108.00

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (57)

PMID Text
26555036 These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells
25847191 polymorphisms of the DPYSL2 gene in humans may be associated with the development of schizophrenia.
25760044 HIV-1 Tat induces hyperphosphorylation of CRMP2 in neuronal cells
25416705 Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling
25224486 Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs.
24634145 Levels of total GSK3 were decreased in the Huntington disease-affected frontal cortex and this correlated with decreased phosphorylated CRMP2.
24518087 High dihydropyrimidinase-related protein 2 expression is associated with lung cancer.
24133216 A specific and reversible intermolecular Cys-504-Cys-504 dithiol-disulfide switch in homotetrameric CRMP2 determines two conformations of the quaternary CRMP2 complex that controls axonal outgrowth and thus neuronal development.
24036111 CRMP-2-dependent regulation of ROCK II activity is mediated through interaction of the CRMP-2L N terminus with the ROCK II catalytic domain as well as by GSK3-dependent phosphorylation of CRMP-2.
23846846 genetic variants in DPYSL2 may play a role in susceptibility to alcohol dependence.
More...

AA Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGI      1 - 70
DVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVD     71 - 140
ISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQ    141 - 210
RILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPIT    211 - 280
ASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL    281 - 350
IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI    351 - 420
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE    421 - 490
LRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVA    491 - 560
PPGGRANITSLG                                                              561 - 572
//

Text Mined References (95)

PMID Year Title
26555036 2015 Phosphorylation of a splice variant of collapsin response mediator protein 2 in the nucleus of tumour cells links cyclin dependent kinase-5 to oncogenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25847191 2015 Changes in Dpysl2 expression are associated with prenatally stressed rat offspring and susceptibility to schizophrenia in humans.
25416956 2014 A proteome-scale map of the human interactome network.
25416705 2014 Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling.
25224486 2015 Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.
24634145 2014 Localized changes to glycogen synthase kinase-3 and collapsin response mediator protein-2 in the Huntington's disease affected brain.
24518087 2014 Discovery of new membrane-associated proteins overexpressed in small-cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24133216 2013 Identification of a dithiol-disulfide switch in collapsin response mediator protein 2 (CRMP2) that is toggled in a model of neuronal differentiation.
More...