Property Summary

NCBI Gene PubMed Count 79
PubMed Score 212.54
PubTator Score 108.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 1.39848921508473E-37
non-small cell lung cancer 2798 1.14000375591057E-23
lung adenocarcinoma 2714 6.25581437432265E-16
Breast cancer 3099 2.74041090231478E-13
tuberculosis 1563 8.59980809786284E-10
ovarian cancer 8492 7.89999448155923E-8
Duchenne muscular dystrophy 602 1.85911329776553E-7
lung cancer 4473 3.34606680813941E-6
atypical teratoid / rhabdoid tumor 4369 2.21195220885825E-4
invasive ductal carcinoma 2950 4.68666872816989E-4
ulcerative colitis 2087 6.75431054420662E-4
pancreatic cancer 2300 9.7622372553082E-4
ductal carcinoma in situ 1745 0.0016414694768971
primary pancreatic ductal adenocarcinoma 1271 0.001742482994501
acute myeloid leukemia 785 0.00183238726452745
medulloblastoma, large-cell 6234 0.00232205977007732
limb girdle muscular dystrophy 2I 56 0.00363744648823174
Becker muscular dystrophy 187 0.00682731866078526
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00737279694472258
subependymal giant cell astrocytoma 2287 0.0082701648274316
gastric carcinoma 832 0.013519929775489
dermatomyositis 967 0.0148670019867171
Waldenstrons macroglobulinemia 765 0.0327619308791557
Disease Target Count Z-score Confidence
Schizophrenia 503 4.026 2.0
Epilepsy 346 3.446 1.7

Expression

Synonym

Accession Q16555 A8K5H2 B4DR31 D3DSS7 O00424 DRP-2
Symbols DRP2
N2A3
CRMP2
DRP-2
ULIP2
CRMP-2
DHPRP2
ULIP-2

Gene

PANTHER Protein Class (1)

PDB

2GSE   2VM8  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid

 GO Function (1)

Gene RIF (57)

PMID Text
26555036 These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells
25847191 polymorphisms of the DPYSL2 gene in humans may be associated with the development of schizophrenia.
25760044 HIV-1 Tat induces hyperphosphorylation of CRMP2 in neuronal cells
25416705 Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling
25224486 Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs.
24634145 Levels of total GSK3 were decreased in the Huntington disease-affected frontal cortex and this correlated with decreased phosphorylated CRMP2.
24518087 High dihydropyrimidinase-related protein 2 expression is associated with lung cancer.
24133216 A specific and reversible intermolecular Cys-504-Cys-504 dithiol-disulfide switch in homotetrameric CRMP2 determines two conformations of the quaternary CRMP2 complex that controls axonal outgrowth and thus neuronal development.
24036111 CRMP-2-dependent regulation of ROCK II activity is mediated through interaction of the CRMP-2L N terminus with the ROCK II catalytic domain as well as by GSK3-dependent phosphorylation of CRMP-2.
23846846 genetic variants in DPYSL2 may play a role in susceptibility to alcohol dependence.
More...

AA Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGI      1 - 70
DVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVD     71 - 140
ISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQ    141 - 210
RILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPIT    211 - 280
ASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL    281 - 350
IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI    351 - 420
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE    421 - 490
LRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVA    491 - 560
PPGGRANITSLG                                                              561 - 572
//

Text Mined References (95)

PMID Year Title
26555036 2015 Phosphorylation of a splice variant of collapsin response mediator protein 2 in the nucleus of tumour cells links cyclin dependent kinase-5 to oncogenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25847191 2015 Changes in Dpysl2 expression are associated with prenatally stressed rat offspring and susceptibility to schizophrenia in humans.
25416956 2014 A proteome-scale map of the human interactome network.
25416705 2014 Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling.
25224486 2015 Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.
24634145 2014 Localized changes to glycogen synthase kinase-3 and collapsin response mediator protein-2 in the Huntington's disease affected brain.
24518087 2014 Discovery of new membrane-associated proteins overexpressed in small-cell lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24133216 2013 Identification of a dithiol-disulfide switch in collapsin response mediator protein 2 (CRMP2) that is toggled in a model of neuronal differentiation.
More...