| Tbio | Dihydropyrimidinase-related protein 2 |
Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. May play a role in endocytosis.
This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
Comments
| Disease | Target Count |
|---|---|
| Alzheimer's disease | 644 |
| Degenerative polyarthritis | 93 |
| Paranoid schizophrenia | 3 |
| Disease | log2 FC | p |
|---|---|---|
| Waldenstrons macroglobulinemia | 1.548 | 0.033 |
| atypical teratoid / rhabdoid tumor | -1.900 | 0.000 |
| medulloblastoma, large-cell | -1.600 | 0.002 |
| Duchenne muscular dystrophy | 1.589 | 0.000 |
| limb girdle muscular dystrophy 2I | 1.054 | 0.004 |
| autosomal dominant Emery-Dreifuss muscul... | 1.402 | 0.007 |
| Becker muscular dystrophy | 1.204 | 0.007 |
| tuberculosis | 2.500 | 0.000 |
| primary pancreatic ductal adenocarcinoma | 1.487 | 0.002 |
| non-small cell lung cancer | -1.955 | 0.000 |
| lung cancer | -2.800 | 0.000 |
| lung adenocarcinoma | -2.300 | 0.000 |
| subependymal giant cell astrocytoma | -1.248 | 0.008 |
| Breast cancer | -2.300 | 0.000 |
| breast carcinoma | -1.600 | 0.000 |
| gastric carcinoma | 1.200 | 0.014 |
| ductal carcinoma in situ | -1.100 | 0.002 |
| invasive ductal carcinoma | -1.900 | 0.000 |
| acute myeloid leukemia | -2.600 | 0.002 |
| ulcerative colitis | 1.100 | 0.001 |
| ovarian cancer | -3.700 | 0.000 |
| pancreatic cancer | 1.500 | 0.001 |
| dermatomyositis | 1.100 | 0.015 |
| Species | Source |
|---|---|
| Chimp | OMA EggNOG |
| Macaque | OMA EggNOG Inparanoid |
| Mouse | OMA EggNOG Inparanoid |
| Rat | OMA EggNOG Inparanoid |
| Dog | OMA Inparanoid |
| Cow | OMA Inparanoid |
| Chicken | OMA Inparanoid |
| PMID | Text |
|---|---|
| 26555036 | These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells |
| 25847191 | polymorphisms of the DPYSL2 gene in humans may be associated with the development of schizophrenia. |
| 25760044 | HIV-1 Tat induces hyperphosphorylation of CRMP2 in neuronal cells |
| 25416705 | Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling |
| 25224486 | Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs. |
| 24634145 | Levels of total GSK3 were decreased in the Huntington disease-affected frontal cortex and this correlated with decreased phosphorylated CRMP2. |
| 24518087 | High dihydropyrimidinase-related protein 2 expression is associated with lung cancer. |
| 24133216 | A specific and reversible intermolecular Cys-504-Cys-504 dithiol-disulfide switch in homotetrameric CRMP2 determines two conformations of the quaternary CRMP2 complex that controls axonal outgrowth and thus neuronal development. |
| 24036111 | CRMP-2-dependent regulation of ROCK II activity is mediated through interaction of the CRMP-2L N terminus with the ROCK II catalytic domain as well as by GSK3-dependent phosphorylation of CRMP-2. |
| 23846846 | genetic variants in DPYSL2 may play a role in susceptibility to alcohol dependence. |
| More... |
MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGI 1 - 70 DVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVD 71 - 140 ISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQ 141 - 210 RILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPIT 211 - 280 ASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL 281 - 350 IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI 351 - 420 SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE 421 - 490 LRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVA 491 - 560 PPGGRANITSLG 561 - 572 //
| PMID | Year | Title |
|---|---|---|
| 26555036 | 2015 | Phosphorylation of a splice variant of collapsin response mediator protein 2 in the nucleus of tumour cells links cyclin dependent kinase-5 to oncogenesis. |
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
| 25847191 | 2015 | Changes in Dpysl2 expression are associated with prenatally stressed rat offspring and susceptibility to schizophrenia in humans. |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. |
| 25416705 | 2014 | Functional variants in DPYSL2 sequence increase risk of schizophrenia and suggest a link to mTOR signaling. |
| 25224486 | 2015 | Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors. |
| 24634145 | 2014 | Localized changes to glycogen synthase kinase-3 and collapsin response mediator protein-2 in the Huntington's disease affected brain. |
| 24518087 | 2014 | Discovery of new membrane-associated proteins overexpressed in small-cell lung cancer. |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
| 24133216 | 2013 | Identification of a dithiol-disulfide switch in collapsin response mediator protein 2 (CRMP2) that is toggled in a model of neuronal differentiation. |
| More... |
