Property Summary

NCBI Gene PubMed Count 81
PubMed Score 230.24
PubTator Score 108.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -2.600 1.8e-03
atypical teratoid / rhabdoid tumor -1.900 2.2e-04
autosomal dominant Emery-Dreifuss muscul... 1.402 7.4e-03
Becker muscular dystrophy 1.204 6.8e-03
Breast cancer -2.300 2.7e-13
breast carcinoma -1.600 1.4e-37
dermatomyositis 1.100 1.5e-02
Duchenne muscular dystrophy 1.589 1.9e-07
ductal carcinoma in situ -1.100 1.6e-03
gastric carcinoma 1.200 1.4e-02
invasive ductal carcinoma -1.900 4.7e-04
limb girdle muscular dystrophy 2I 1.054 3.6e-03
lung adenocarcinoma -1.100 2.1e-11
lung cancer -2.200 2.3e-05
medulloblastoma, large-cell -1.600 2.3e-03
non-small cell lung cancer -1.955 1.1e-23
ovarian cancer -3.700 7.9e-08
pancreatic cancer 1.500 9.8e-04
primary pancreatic ductal adenocarcinoma 1.487 1.7e-03
subependymal giant cell astrocytoma -1.248 8.3e-03
tuberculosis 2.500 8.6e-10
ulcerative colitis 1.100 6.8e-04
Waldenstrons macroglobulinemia 1.548 3.3e-02

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (59)

AA Sequence

MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGI      1 - 70
DVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVD     71 - 140
ISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQ    141 - 210
RILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPIT    211 - 280
ASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL    281 - 350
IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI    351 - 420
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE    421 - 490
LRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVA    491 - 560
PPGGRANITSLG                                                              561 - 572
//

Text Mined References (97)

PMID Year Title