Property Summary

NCBI Gene PubMed Count 20
PubMed Score 105.03
PubTator Score 42.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Systemic lupus erythematosus 1.200 5.8e-03
active Crohn's disease 1.303 5.0e-02
active ulcerative colitis 1.374 1.1e-02
breast carcinoma 1.200 2.9e-02
cutaneous lupus erythematosus 2.300 6.5e-05
cystic fibrosis 1.031 2.0e-03
group 3 medulloblastoma -1.500 8.0e-04
intraductal papillary-mucinous neoplasm ... 1.400 2.4e-03
juvenile dermatomyositis 2.117 5.0e-12
lung adenocarcinoma 1.093 2.3e-03
lung carcinoma -2.200 6.0e-31
malignant mesothelioma 2.700 1.4e-07
osteosarcoma 1.885 3.8e-03
ovarian cancer -1.800 4.6e-04
pancreatic cancer 1.700 2.0e-05
posterior fossa group A ependymoma -1.100 2.6e-04
primary pancreatic ductal adenocarcinoma 1.159 3.2e-02
Rheumatoid arthritis -1.800 3.5e-02
subependymal giant cell astrocytoma -1.280 1.6e-02
tuberculosis 1.600 6.0e-05

Synonym

Accession Q16553 B2R4X5 D3DWJ2 Q0VDE5 Ly-6E
Symbols RIGE
SCA2
RIG-E
SCA-2
TSA-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKT      1 - 70
CSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP              71 - 131
//

Text Mined References (21)

PMID Year Title