Property Summary

NCBI Gene PubMed Count 18
Grant Count 108
R01 Count 63
Funding $9,896,677.2
PubMed Score 100.74
PubTator Score 42.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16553 B2R4X5 D3DWJ2 Q0VDE5 Ly-6E
Symbols RIGE
SCA2
RIG-E
SCA-2
TSA-1

Gene

Gene RIF (6)

PMID Text
25344775 LY6E level of gene expression may serve as good biomarkers for systemic lupus erythematosus diagnosis.
25225669 the LY6E pathway in monocytes represents one of negative feedback mechanisms that counterbalance monocyte activation which may serve as a potential target for immune intervention.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19672991 This study suggested that a mutation in SCA2 or SCA3/MJD may be one of the genetic causes of Parkinson's disease in china.
18990604 Two SCA3 and one SCA2 cases have been identified which show autosomal dominant inheritance in Parkinson disease.
18755862 Increased expression of the type I interferon-inducible gene, lymphocyte antigen 6 complex locus E, in peripheral blood cells is predictive of lupus activity in a large cohort of Chinese lupus patients.

AA Sequence

MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKT      1 - 70
CSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLLSLLPALLRFGP              71 - 131
//

Text Mined References (19)

PMID Year Title
25344775 2015 Identification of interferon-inducible genes as diagnostic biomarker for systemic lupus erythematosus.
25225669 2014 IFN-stimulated gene LY6E in monocytes regulates the CD14/TLR4 pathway but inadequately restrains the hyperactivation of monocytes during chronic HIV-1 infection.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19672991 2009 Analysis of SCA2 and SCA3/MJD repeats in Parkinson's disease in mainland China: genetic, clinical, and positron emission tomography findings.
18990604 2009 Intrafamilial variability of Parkinson phenotype in SCAs: novel cases due to SCA2 and SCA3 expansions.
18755862 2008 Increased expression of the type I interferon-inducible gene, lymphocyte antigen 6 complex locus E, in peripheral blood cells is predictive of lupus activity in a large cohort of Chinese lupus patients.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12516096 2003 Characterization of the human Ly-6 antigens, the newly annotated member Ly-6K included, as molecular markers for head-and-neck squamous cell carcinoma.
More...