Property Summary

NCBI Gene PubMed Count 888
Grant Count 1,657
R01 Count 734
Funding $220,262,422.74
PubMed Score 4274.15
PubTator Score 2471.29

Knowledge Summary

Patent

No data available

Synonym

Accession Q16552 Q5T2P0 IL-17
Symbols IL17
CTLA8
IL-17
CTLA-8
IL-17A

Gene

PDB

4HSA   2VXS   4HR9   4QHU   5HHV   5HHX   5HI3   5HI4   5HI5  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
624278 other 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): Fluorescence-based cell-based QPCR assays to determine endogenous expression of ROR gamma target genes, proinflammatory IL-17 and IL-23R

Gene RIF (873)

PMID Text
27049090 IL-17A content of the ulcerative colitis group and Crohns disease group was significantly higher than that of the normal control group
26910014 The presence of allele A in the IL-17 gene polymorphism (-197A/G) can be considered a risk factor for the development of chronic periodontitis and localized aggressive periodontitis.
26890073 no difference was observed in acute gout patients between different genotypic carriers of rs2275913 and rs763780 regarding serum IL-17A and IL-17F levels (p>0.05).
26875893 IL-17A promotes migration of hepatocellular carcinoma cells and prevents autophagic cell death from starvation by activating TAB2/p38 MAPK and TAB3/p38 MAPK.
26867135 IL-17A and IL-22 work synergistically to induce antimicrobials and chemokines such as IL-8, components of calprotectin (CP), lipocalin (LCN) and some beta-defensins in both human and primary mouse gastric epithelial cells (GEC) and gastroids
26850593 These results indicate an essential role for MAPKs in the induction of MMP-3 in synovial sarcoma cells, through AP-1 activation.
26840977 The results show a protective effect of IL17 and IL6 polymorphisms on Pulmonary Tuberculosis outcome in Southern Brazilian population.
26805737 IL-17 plays a role in lung cancer progression via different mechanisms. [review]
26783383 IL-17 might also be a culprit in bone destruction caused by late stage bone metastasis[review]
26780388 IL-17A, and IL-17F, proinflammatory cytokines, similarly exhibited strong osteogenic effects when exposed directly to mesenchymal stem cells.
More...

AA Sequence

MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRS      1 - 70
TSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILV     71 - 140
SVGCTCVTPIVHHVA                                                           141 - 155
//

Text Mined References (891)

PMID Year Title
27049090 Relationship between serum interleukin-17 level and inflammatory bowel disease.
26910014 2016 Association of Interleukin-17 polymorphism (-197G/A) in chronic and localized aggressive periodontitis.
26890073 2016 Genetic Analysis of IL-17 Gene Polymorphisms in Gout in a Male Chinese Han Population.
26875893 2016 Interleukin-17A inhibits cell autophagy under starvation and promotes cell migration via TAB2/TAB3-p38 mitogen-activated protein kinase pathways in hepatocellular carcinoma.
26867135 2016 IL-17a and IL-22 Induce Expression of Antimicrobials in Gastrointestinal Epithelial Cells and May Contribute to Epithelial Cell Defense against Helicobacter pylori.
26850593 2016 Essential role of mitogen-activated protein kinases in IL-17A-induced MMP-3 expression in human synovial sarcoma cells.
26840977 2016 Single Nucleotide Polymorphisms in IL17A and IL6 Are Associated with Decreased Risk for Pulmonary Tuberculosis in Southern Brazilian Population.
26805737 2016 [Role of Interleukin 17 in Lung Carcinogenesis and Lung Cancer Progression].
26783383 2015 Interleukin-17 Could Promote Breast Cancer Progression at Several Stages of the Disease.
26780388 2016 Proinflammatory T cells and IL-17 stimulate osteoblast differentiation.
More...