Property Summary

Ligand Count 4
NCBI Gene PubMed Count 39
PubMed Score 185.47
PubTator Score 107.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.300 3.8e-03
interstitial cystitis 1.200 4.9e-03
non-inflammatory breast cancer -1.300 2.4e-02
oligodendroglioma 1.500 3.8e-03
osteosarcoma -1.231 8.1e-03
ovarian cancer -1.200 2.9e-06
psoriasis 1.700 5.8e-05

Gene RIF (22)

AA Sequence

MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLESLEGDGEEETL      1 - 70
EQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAK     71 - 140
RSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLN    141 - 210
SNDPDPMPHPDVENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQI    211 - 280
NDIYSCSWGPDDDGKTVDGPHQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVT    281 - 350
IGAVDEEGRMPFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML    351 - 420
QVRPCLTWRDVQHIIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVS    421 - 490
PVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRGSLELKLFCPSGMMSLIGAPR    491 - 560
SMDSDPNGFNDWTFSTVRCWGERARGTYRLVIRDVGDESFQVGILRQWQLTLYGSVWSAVDIRDRQRLLE    561 - 630
SAMSGKYLHDDFALPCPPGLKIPEEDGYTITPNTLKTLVLVGCFTVFWTVYYMLEVYLSQRNVASNQVCR    631 - 700
SGPCHWPHRSRKAKEEGTELESVPLCSSKDPDEVETESRGPPTTSDLLAPDLLEQGDWSLSQNKSALDCP    701 - 770
HQHLDVPHGKEEQIC                                                           771 - 785
//

Text Mined References (40)

PMID Year Title