Property Summary

NCBI Gene PubMed Count 37
Grant Count 15
R01 Count 11
Funding $868,127.89
PubMed Score 172.30
PubTator Score 107.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.300 0.004
oligodendroglioma 1.500 0.004
psoriasis 1.700 0.000
osteosarcoma -1.231 0.008
interstitial cystitis 1.200 0.005
non-inflammatory breast cancer -1.300 0.024
ovarian cancer -1.200 0.000

Gene RIF (20)

PMID Text
25504030 The data suggest that PCSK7 genotypes may interact with dietary CHO intake on changes in insulin sensitivity in the white Americans.
24556216 Results demonstrate that PCSK7 variation is a strong host risk factor of liver cirrhosis in hereditary hemochromatosis patients homozygous for HFE C282Y.
24436242 Furin and PC7 siRNAs induced HIF-1alpha protein by increasing its translation, resulting in upregulation of VEGF-A.
23686857 overexpression of PCs, furin and PC5, but not PC7, which are all expressed in SMC, increase PKGI cleavage in a dose-dependent manner
23390091 Among the PC family members, only furin activates hepcidin in hepatocytes, and uniquely the full-length membrane-bound PC7 can directly shed hTfR1 by cleavage at Arg100
22294700 Region encoded by amino acids ala713-asp730 is essential and sufficient for endocytosis.
21209099 Proprotein convertase PC7 enhances the activation of the EGF receptor pathway through processing of the EGF precursor.
21149283 PCSK7 is involved in sTfR generation and iron homeostasis.
21075846 PC7 is distinct from other proprotein convertases in its zymogen activation, subcellular localization, and trafficking.
20164418 Mass spectrometry analysis provides evidence that the HLA-B51-presented peptide profile is altered in the absence of peptide-loading complex quality control or lack of PC7 function in major histocompatibility (MHC) class I-mediated antigen presentation.
More...

AA Sequence

MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLESLEGDGEEETL      1 - 70
EQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAVLAGHEAVRWHSEQRLLRRAK     71 - 140
RSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRGVTVVVVDDGVEHTIQDIAPNYSPEGSYDLN    141 - 210
SNDPDPMPHPDVENGNHHGTRCAGEIAAVPNNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQI    211 - 280
NDIYSCSWGPDDDGKTVDGPHQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVT    281 - 350
IGAVDEEGRMPFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML    351 - 420
QVRPCLTWRDVQHIIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWTSVPYLASYVS    421 - 490
PVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRGSLELKLFCPSGMMSLIGAPR    491 - 560
SMDSDPNGFNDWTFSTVRCWGERARGTYRLVIRDVGDESFQVGILRQWQLTLYGSVWSAVDIRDRQRLLE    561 - 630
SAMSGKYLHDDFALPCPPGLKIPEEDGYTITPNTLKTLVLVGCFTVFWTVYYMLEVYLSQRNVASNQVCR    631 - 700
SGPCHWPHRSRKAKEEGTELESVPLCSSKDPDEVETESRGPPTTSDLLAPDLLEQGDWSLSQNKSALDCP    701 - 770
HQHLDVPHGKEEQIC                                                           771 - 785
//

Text Mined References (38)

PMID Year Title
25504030 2015 PCSK7 genotype modifies effect of a weight-loss diet on 2-year changes of insulin resistance: the POUNDS LOST trial.
24556216 2014 Evaluation of genome-wide loci of iron metabolism in hereditary hemochromatosis identifies PCSK7 as a host risk factor of liver cirrhosis.
24436242 2015 Regulation of HIF-1 alpha by the proprotein convertases furin and PC7 in human squamous carcinoma cells.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
23686857 2013 Proprotein convertases play an important role in regulating PKGI endoproteolytic cleavage and nuclear transport.
23390091 2013 Implication of the proprotein convertases in iron homeostasis: proprotein convertase 7 sheds human transferrin receptor 1 and furin activates hepcidin.
22679642 2012 The biology and therapeutic targeting of the proprotein convertases.
22294700 2012 Internalization of proprotein convertase PC7 from plasma membrane is mediated by a novel motif.
21805237 2011 The proprotein convertases, 20 years later.
21805236 2011 The prohormone theory and the proprotein convertases: it is all about serendipity.
More...