Property Summary

NCBI Gene PubMed Count 80
Grant Count 255
R01 Count 112
Funding $25,587,586.89
PubMed Score 1066.36
PubTator Score 786.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Synonym

Accession Q16548 Q6FGZ4 Q6FH19 Q86W13 Q99524
Symbols GRS
ACC1
ACC2
BFL1
ACC-1
ACC-2
HBPA1
BCL2L5

Gene

PANTHER Protein Class (1)

PDB

3MQP   4ZEQ   2VM6   3I1H  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1008 screening 237 / 439 / 194168 Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bfl-1
1320 confirmatory 97 / 0 / 737 Multiplexed dose response screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bfl-1.
2080 confirmatory 23 / 0 / 19 Confirmation dose response of hits from multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bfl-1

Gene RIF (57)

PMID Text
27386628 Demonstrate immunohistochemical expression of Wnt11 and BCL2A1 in complete moles and normal villi.
25486183 Bfl-1 was mitochondrially resident in both resting and apoptotic cells and experienced regulation by the proteasome and NFkappaB pathways.
24810636 Bcl2a1 overexpressing granulocytic MDSCs demonstrated prolonged survival.
23841872 BCL2A1 is a novel marker associated with seizure prognosis following surgery for low-grade brain neoplasms.
23480177 Results indicate that mismatches in minor H antigens HA-8 (KIAA0020) and ACC-1 (BCL2A1) predisposed to chronic graft-versus-host disease (GvHD).
23447565 MITF-BCL2A1 as a lineage-specific oncogenic pathway in melanoma and underscore its role for improved response to BRAF-directed therapy.
23152563 Mitochondrial antiapoptotic factor Bfl-1 is significantly reduced by suppressor of cytokine signaling (SOCS)1.
23118966 Bcl2a1 should be considered as a proto-oncogene with a potential role in both lymphoid and myeloid leukemogenesis
22865454 Data indicate that BCL2a1 expression enhances tumor cell survival in nervous system (CNS) leading to intracranial tumor growth.
22745672 Data demonstrate that calpain-mediated cleavage of full-length Bfl-1 induces the release of C-terminal membrane active alpha-helices that are responsible for its conversion into a pro-apoptotic factor.
More...

AA Sequence

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTL      1 - 70
FNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW     71 - 140
ENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC                                       141 - 175
//

Text Mined References (83)

PMID Year Title
27386628 2016 Immunohistochemical Expression and Clinical Significance of Wnt11 and BCL2A1 in Complete Moles.
25486183 2015 Role of the pro-survival molecule Bfl-1 in melanoma.
25416956 2014 A proteome-scale map of the human interactome network.
24810636 2014 IFN-? regulates survival and function of tumor-induced CD11b+ Gr-1high myeloid derived suppressor cells by modulating the anti-apoptotic molecule Bcl2a1.
23841872 2013 BCL2A1 is a potential biomarker for postoperative seizure control in patients with low-grade gliomas.
23480177 2013 Minor histocompatibility antigens as determinants for graft-versus-host disease after allogeneic haematopoietic stem cell transplantation.
23447565 2013 BCL2A1 is a lineage-specific antiapoptotic melanoma oncogene that confers resistance to BRAF inhibition.
23152563 2012 Suppressors of cytokine signaling promote Fas-induced apoptosis through downregulation of NF-?B and mitochondrial Bfl-1 in leukemic T cells.
23118966 2012 BCL2A1a over-expression in murine hematopoietic stem and progenitor cells decreases apoptosis and results in hematopoietic transformation.
23055042 2012 Human Bop is a novel BH3-only member of the Bcl-2 protein family.
More...