Property Summary

Ligand Count 22
NCBI Gene PubMed Count 80
PubMed Score 1146.15
PubTator Score 786.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid arthritis 1.100 4.6e-02
adult high grade glioma 1.200 1.5e-02
Bipolar Disorder 1.869 4.0e-02
cutaneous lupus erythematosus 2.600 1.6e-03
cystic fibrosis 3.750 6.5e-06
ductal carcinoma in situ 2.200 4.6e-03
ependymoma 1.100 1.4e-02
gastric carcinoma 2.700 1.8e-02
glioblastoma 1.500 1.2e-03
head and neck cancer and chronic obstruc... 1.300 4.1e-02
interstitial cystitis 2.800 1.8e-03
invasive ductal carcinoma 2.216 2.0e-02
lung adenocarcinoma -1.215 2.9e-03
lung cancer -3.900 3.3e-07
lung carcinoma -1.700 1.1e-17
malignant mesothelioma -3.900 7.6e-09
medulloblastoma -1.100 2.2e-04
medulloblastoma, large-cell -1.300 4.7e-04
nasopharyngeal carcinoma 1.600 4.2e-02
non-small cell lung cancer -1.700 1.1e-10
osteosarcoma -3.339 1.1e-02
pancreatic cancer 1.800 4.2e-04
primary Sjogren syndrome 1.700 3.3e-03
psoriasis 1.200 5.8e-03
ulcerative colitis 4.800 1.1e-06
Waldenstrons macroglobulinemia 1.313 4.5e-02

Synonym

Accession Q16548 Q6FGZ4 Q6FH19 Q86W13 Q99524
Symbols GRS
ACC1
ACC2
BFL1
ACC-1
ACC-2
HBPA1
BCL2L5

Gene

PANTHER Protein Class (1)

PDB

3MQP   4ZEQ   2VM6   5UUL   3I1H   5UUK   5UUP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (57)

AA Sequence

MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTL      1 - 70
FNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGW     71 - 140
ENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC                                       141 - 175
//

Text Mined References (83)

PMID Year Title