Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.49
PubTator Score 2.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 1.6e-05

Gene RIF (4)

AA Sequence

MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRT      1 - 70
RVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSS     71 - 140
DPRRGGVPSWFGL                                                             141 - 153
//

Text Mined References (20)

PMID Year Title