Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.49
PubTator Score 2.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.500 0.000

Synonym

Accession Q16540 A8MT29 Q96Q71 L23mt
Symbols RPL23
L23MRP
RPL23L

Gene

PDB

3J9M   3J7Y  

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19304784 Meta-analysis of gene-disease association. (HuGE Navigator)
18976975 Knockdown of mitochondrial ribosomal protein L23 (MRPL23) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17242401 5-FU treatment triggers a ribosomal stress response so that ribosomal proteins L5, L11, and L23 are released from ribosome to activate p53 by ablating the MDM2-p53 feedback circuit

AA Sequence

MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRT      1 - 70
RVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSS     71 - 140
DPRRGGVPSWFGL                                                             141 - 153
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19304784 2009 Association between invasive ovarian cancer susceptibility and 11 best candidate SNPs from breast cancer genome-wide association study.
17242401 2007 5-fluorouracil activation of p53 involves an MDM2-ribosomal protein interaction.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...