Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.01
PubTator Score 29.64

Knowledge Summary

Patent (1,309)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.400 3.1e-05
astrocytoma -1.100 4.5e-02
atypical teratoid / rhabdoid tumor -2.000 4.8e-07
glioblastoma -1.100 5.8e-03
medulloblastoma -1.200 1.7e-03
medulloblastoma, large-cell -2.500 4.4e-06
primitive neuroectodermal tumor -1.100 5.9e-04

Gene RIF (2)

AA Sequence

MARGGAGAEEASLRSNALSWLACGLLALLANAWIILSISAKQQKHKPLELLLCFLAGTHILMAAVPLTTF      1 - 70
AVVQLRRQASSDYDWNESICKVFVSTYYTLALATCFTVASLSYHRMWMVRWPVNYRLSNAKKQALHAVMG     71 - 140
IWMVSFILSTLPSIGWHNNGERYYARGCQFIVSKIGLGFGVCFSLLLLGGIVMGLVCVAITFYQTLWARP    141 - 210
RRARQARRVGGGGGTKAGGPGALGTRPAFEVPAIVVEDARGKRRSSLDGSESAKTSLQVTNLVSAIVFLY    211 - 280
DSLTGVPILVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDG    281 - 350
DDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIF    351 - 420
STPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGS    421 - 490
GGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRC    491 - 560
SLTGGEESARAWGGSWGPGNPIFPQLTL                                              561 - 588
//

Text Mined References (7)

PMID Year Title