Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.81
PubTator Score 29.64

Knowledge Summary

Patent (1,309)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma -1.100 0.045
glioblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma -1.200 0.002
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.100 0.001
adult high grade glioma -1.400 0.000

Gene RIF (2)

PMID Text
26827797 Data show certain SNPs variants in GPR162 gene associated with impairments in glucose homeostasis in obese patients.
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARGGAGAEEASLRSNALSWLACGLLALLANAWIILSISAKQQKHKPLELLLCFLAGTHILMAAVPLTTF      1 - 70
AVVQLRRQASSDYDWNESICKVFVSTYYTLALATCFTVASLSYHRMWMVRWPVNYRLSNAKKQALHAVMG     71 - 140
IWMVSFILSTLPSIGWHNNGERYYARGCQFIVSKIGLGFGVCFSLLLLGGIVMGLVCVAITFYQTLWARP    141 - 210
RRARQARRVGGGGGTKAGGPGALGTRPAFEVPAIVVEDARGKRRSSLDGSESAKTSLQVTNLVSAIVFLY    211 - 280
DSLTGVPILVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDG    281 - 350
DDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIF    351 - 420
STPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGS    421 - 490
GGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRC    491 - 560
SLTGGEESARAWGGSWGPGNPIFPQLTL                                              561 - 588
//

Text Mined References (7)

PMID Year Title
26827797 2016 mRNA GPR162 changes are associated with decreased food intake in rat, and its human genetic variants with impairments in glucose homeostasis in two Swedish cohorts.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9074930 1997 Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination.
8723724 1996 A gene-rich cluster between the CD4 and triosephosphate isomerase genes at human chromosome 12p13.