Property Summary

NCBI Gene PubMed Count 37
PubMed Score 5.54
PubTator Score 8.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.300 1.2e-03
astrocytic glioma -1.600 2.7e-02
atypical teratoid / rhabdoid tumor -1.400 2.3e-04
Breast cancer -1.100 1.1e-08
breast carcinoma 1.100 8.4e-03
ependymoma -1.200 5.2e-03
glioblastoma -1.100 4.4e-08
intraductal papillary-mucinous adenoma (... 1.200 1.5e-02
intraductal papillary-mucinous carcinoma... 1.300 1.8e-02
osteosarcoma -2.344 1.1e-05
ovarian cancer -1.700 5.7e-07
Rheumatoid arthritis 1.600 8.1e-03
ulcerative colitis -1.322 1.1e-02

Gene RIF (20)

AA Sequence

MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQC      1 - 70
CVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEED     71 - 140
EPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKF    141 - 210
LGLRAFIRKQINNIFLRFVYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLF    211 - 280
HAQLAYCIVQFLEKDPSLTEPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAK    281 - 350
CVSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST    351 - 420
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT                           421 - 467
//

Text Mined References (46)

PMID Year Title