Property Summary

NCBI Gene PubMed Count 31
PubMed Score 5.15
PubTator Score 8.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.008
astrocytic glioma -1.600 0.027
ependymoma -1.200 0.005
osteosarcoma -2.344 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
ulcerative colitis -1.322 0.011
intraductal papillary-mucinous adenoma (... 1.200 0.015
intraductal papillary-mucinous carcinoma... 1.300 0.018
breast carcinoma 1.100 0.008
adult high grade glioma -1.300 0.001
Breast cancer -1.100 0.000
ovarian cancer -1.700 0.000

Synonym

Gene

Gene RIF (22)

PMID Text
25772433 PP2A holoenzyme containing B56 is responsible for the dephosphorylation of gamma-H2AX and regulation of DNA repair of double strand breaks induced by camptothecin.
25512391 KIF4A and PP2A-B56G and -B56E create a spatially restricted negative feedback loop counteracting Aurora B in anaphase.
24997345 the significance of miR-23a and PPP2R5E in the proliferation and apoptosis of gastric cancer cells
24204789 The two functional variants in PPP2R1A and PPP2R5E and their combinations are associated with lung cancer risk in the Chinese.
23812941 Downregulation of PPP2R5E affects the oncogenic potential of leukemic cells.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22190034 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
More...

AA Sequence

MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQC      1 - 70
CVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEED     71 - 140
EPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKF    141 - 210
LGLRAFIRKQINNIFLRFVYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLF    211 - 280
HAQLAYCIVQFLEKDPSLTEPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAK    281 - 350
CVSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST    351 - 420
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT                           421 - 467
//

Text Mined References (40)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772433 2015 PP2A-B56? complex is involved in dephosphorylation of ?-H2AX in the repair process of CPT-induced DNA double-strand breaks.
25512391 2014 KIF4A and PP2A-B56 form a spatially restricted feedback loop opposing Aurora B at the anaphase central spindle.
24997345 2014 Downregulation of PPP2R5E expression by miR-23a suppresses apoptosis to facilitate the growth of gastric cancer cells.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24204789 2013 Functional genetic polymorphisms in PP2A subunit genes confer increased risks of lung cancer in southern and eastern Chinese.
23812941 2013 Downregulation of PPP2R5E is a common event in acute myeloid leukemia that affects the oncogenic potential of leukemic cells.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...