Property Summary

NCBI Gene PubMed Count 31
PubMed Score 18.21
PubTator Score 190.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
breast carcinoma 1614 1.53079084883944E-37
non-small cell lung cancer 2798 4.02149741657665E-23
periodontitis 269 9.79179553966043E-21
atypical teratoid / rhabdoid tumor 4369 4.46559842263132E-13
ovarian cancer 8492 3.52322770815952E-12
oligodendroglioma 2849 2.0100146781747E-11
lung adenocarcinoma 2714 1.66408452680837E-8
pituitary cancer 1972 8.62443168123403E-8
glioblastoma 5572 1.61500534544544E-6
pilocytic astrocytoma 3086 2.31435511454421E-6
lung cancer 4473 4.53686388155168E-6
pediatric high grade glioma 2712 1.72485931812346E-5
colon cancer 1475 3.07527089688969E-5
primitive neuroectodermal tumor 3031 4.14013861738599E-5
ductal carcinoma in situ 1745 5.05051018287628E-5
invasive ductal carcinoma 2950 5.15151815657225E-5
medulloblastoma, large-cell 6234 5.81143791856223E-5
cutaneous lupus erythematosus 1056 1.20932891530456E-4
Atopic dermatitis 944 2.71825900673171E-4
interstitial cystitis 2299 9.90262589899766E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00182936931647525
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00219656787331957
psoriasis 6685 0.00272769196327545
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00300477068100947
astrocytic glioma 2241 0.00451828118201653
ependymoma 2514 0.00455463945125035
osteosarcoma 7933 0.0045549876808565
group 3 medulloblastoma 2254 0.00473764211923387
head and neck cancer 270 0.00661291095017507
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0154331124493451
Breast cancer 3099 0.0230083177701463
esophageal adenocarcinoma 737 0.0312896847529202
subependymal giant cell astrocytoma 2287 0.0440435590636054
adrenocortical carcinoma 1427 0.0483687671838329
Disease Target Count Z-score Confidence
Gout 93 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 88 3.196 1.6

Expression

Synonym

Accession Q16534 A8K1X8 Q6FHS9
Symbols

Gene

HLF

PANTHER Protein Class (1)

  Ortholog (12)

Gene RIF (12)

PMID Text
26214592 Drug response profiling of matched patient-derived xenografts revealed a distinct profile for TCF3-HLF ALL with resistance to conventional chemotherapeutics but sensitivity to glucocorticoids.
23415677 ectopic expression of HLF, an established transcription factor that cycles with circadian rhythms, can recapitulate many features associated with circadian-dependent physiological variation.
21072044 both Lmo2 and Bcl-2 are required for the action of E2A-HLF in leukemogenesis
20519628 E2A-HLF promotes cell survival of t(17;19)- acute lymphoblastic leukemia cells by aberrantly up-regulating LMO2 expression
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18239067 Activation of the thyroid hormone receptor beta/retinoid X receptor alpha heterodimer by T(3) stimulated expression of the hepatic leukemia factor, which increases HIF-1alpha gene expression.
17183364 In childhood acute lymphoblastic leukemia and hypercalcemia, translocation was observed in E2A-HLF fusion protein.
16215946 The patients with immunophenotype of Pre-B-acute lymphoblastic leukemia were found to carry: E2A/PBX1 and E2A/HLF.
16206189 The E2A-HLF-mediated over-expression of ABCB1 may play a role in the clinical phenotype of ALLs with a t(17;19), suggesting pharmacologic modulation of ABCB1 activity as a rational therapeutic strategy for this chemotherapy resistant subtype of ALL.
15070701 E2A-HLF induces annexin II by substituting for cytokines that activate downstream pathways of Ras
More...

AA Sequence

MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLW      1 - 70
DKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPS     71 - 140
PNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPM    141 - 210
IKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGK    211 - 280
CKNILAKYEARHGPL                                                           281 - 295
//

Text Mined References (33)

PMID Year Title
26214592 2015 Genomics and drug profiling of fatal TCF3-HLF-positive acute lymphoblastic leukemia identifies recurrent mutation patterns and therapeutic options.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
23415677 2013 Hepatic leukemia factor promotes resistance to cell death: implications for therapeutics and chronotherapy.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
21072044 2011 The E2A-HLF oncogenic fusion protein acts through Lmo2 and Bcl-2 to immortalize hematopoietic progenitors.
20519628 2010 Aberrant induction of LMO2 by the E2A-HLF chimeric transcription factor and its implication in leukemogenesis of B-precursor ALL with t(17;19).
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
18239067 2008 Thyroid hormone induces hypoxia-inducible factor 1alpha gene expression through thyroid hormone receptor beta/retinoid x receptor alpha-dependent activation of hepatic leukemia factor.
17183364 2007 Hypercalcemia in childhood acute lymphoblastic leukemia: frequent implication of parathyroid hormone-related peptide and E2A-HLF from translocation 17;19.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...