Property Summary

NCBI Gene PubMed Count 33
PubMed Score 20.50
PubTator Score 190.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Precursor Cell Lymphoblastic Leukemia-Lymphoma 49 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gout 106 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 104 3.285 1.6

Expression

  Differential Expression (34)

Disease log2 FC p
adrenocortical carcinoma -1.462 4.8e-02
adult high grade glioma -2.500 3.3e-03
astrocytic glioma -2.800 4.5e-03
Astrocytoma, Pilocytic -2.100 4.1e-04
Atopic dermatitis -1.300 2.7e-04
atypical teratoid / rhabdoid tumor -5.100 4.5e-13
Breast cancer -3.100 2.3e-02
breast carcinoma -1.200 2.9e-04
colon cancer -2.200 2.0e-02
cutaneous lupus erythematosus -1.800 2.8e-04
ductal carcinoma in situ -2.900 5.1e-05
ependymoma -3.400 4.6e-03
esophageal adenocarcinoma -2.000 3.1e-02
glioblastoma -3.000 4.0e-07
group 3 medulloblastoma -3.100 4.7e-03
head and neck cancer -1.200 3.4e-02
interstitial cystitis -1.500 1.7e-02
intraductal papillary-mucinous adenoma (... -1.400 1.8e-03
intraductal papillary-mucinous carcinoma... -1.500 2.5e-03
intraductal papillary-mucinous neoplasm ... -1.200 3.5e-02
invasive ductal carcinoma -1.253 1.4e-02
lung adenocarcinoma -1.900 1.1e-14
lung cancer -4.000 1.4e-05
medulloblastoma, large-cell -4.200 5.8e-05
non-small cell lung cancer -1.323 4.9e-07
oligodendroglioma -1.700 2.6e-02
osteosarcoma -2.193 4.6e-03
ovarian cancer -2.300 3.5e-12
pancreatic ductal adenocarcinoma liver m... -2.225 3.0e-03
periodontitis -1.100 9.8e-21
pituitary cancer 1.800 8.6e-08
primitive neuroectodermal tumor -4.300 4.1e-05
psoriasis -1.300 1.6e-05
subependymal giant cell astrocytoma -3.142 4.4e-02

Gene RIF (14)

AA Sequence

MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLW      1 - 70
DKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPS     71 - 140
PNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPM    141 - 210
IKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGK    211 - 280
CKNILAKYEARHGPL                                                           281 - 295
//

Text Mined References (35)

PMID Year Title