Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.92
PubTator Score 6.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 5.8e-09
ovarian cancer 8520 6.9e-07
malignant mesothelioma 3232 1.2e-06
ulcerative colitis 1819 4.3e-06
pituitary cancer 1972 1.2e-05
tuberculosis 2010 7.4e-05
psoriasis 6694 1.6e-04
cystic fibrosis 1696 2.5e-04
glioblastoma 5792 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (9)

Disease log2 FC p
cystic fibrosis 1.300 2.5e-04
ependymoma 1.400 5.8e-09
glioblastoma 1.100 3.3e-02
malignant mesothelioma 1.200 1.2e-06
ovarian cancer 2.300 6.9e-07
pituitary cancer -1.500 1.2e-05
psoriasis -1.400 1.6e-04
tuberculosis -1.200 7.4e-05
ulcerative colitis 1.200 4.3e-06

Protein-protein Interaction (5)

Gene RIF (2)

AA Sequence

MGTPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWRYFLPPY      1 - 70
TFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAM     71 - 140
PKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKD    141 - 210
DFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSR    211 - 280
RHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEE    281 - 350
NESLSGTEFTASKKRRKH                                                        351 - 368
//

Text Mined References (13)

PMID Year Title