Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $191,175.2
PubMed Score 5.70
PubTator Score 6.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -1.400 0.000
posterior fossa group A ependymoma 1.700 0.000
glioblastoma 1.100 0.033
tuberculosis -1.200 0.000
cystic fibrosis 1.300 0.000
ulcerative colitis 1.200 0.000
ovarian cancer 2.300 0.000
pituitary cancer -1.500 0.000

Synonym

Accession Q16533 SNAPc subunit 1
Symbols SNAP43
PTFgamma

Gene

Gene RIF (2)

PMID Text
22966203 SNAPC1 is a general transcriptional coactivator that functions through elongating RNAPII.
15955816 CK2 may have the capacity to differentially regulate U1 and U6 transcription even though SNAP(C) is universally utilized for human snRNA gene transcription [SNAPC protein, also called PTF or PSE-binding transcription factor]

AA Sequence

MGTPPGLQTDCEALLSRFQETDSVRFEDFTELWRNMKFGTIFCGRMRNLEKNMFTKEALALAWRYFLPPY      1 - 70
TFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAM     71 - 140
PKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKD    141 - 210
DFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSR    211 - 280
RHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEE    281 - 350
NESLSGTEFTASKKRRKH                                                        351 - 368
//

Text Mined References (13)

PMID Year Title
22966203 2012 Requirement for SNAPC1 in transcriptional responsiveness to diverse extracellular signals.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15955816 2005 Cooperation between small nuclear RNA-activating protein complex (SNAPC) and TATA-box-binding protein antagonizes protein kinase CK2 inhibition of DNA binding by SNAPC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12621023 2003 The small nuclear RNA-activating protein 190 Myb DNA binding domain stimulates TATA box-binding protein-TATA box recognition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11094070 2000 The retinoblastoma tumor suppressor protein targets distinct general transcription factors to regulate RNA polymerase III gene expression.
11056176 2001 A map of protein-protein contacts within the small nuclear RNA-activating protein complex SNAPc.
9644240 1998 The human PTFgamma/SNAP43 gene: structure, chromosomal location, and identification of a VNTR in 5'-UTR.
More...