Property Summary

NCBI Gene PubMed Count 70
Grant Count 62
R01 Count 41
Funding $4,996,886.17
PubMed Score 375.99
PubTator Score 127.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma 1.400 0.000
active Crohn's disease 1.180 0.035
ovarian cancer -1.400 0.001

Synonym

Accession Q16526
Symbols PHLL1

Gene

 GO Component (2)

Gene RIF (43)

PMID Text
26966073 Given the distinct characteristics of the C-terminal tails of the CRY1 and CRY2 proteins, our study addresses a long-standing hypothesis that the ratio of these two CRY molecules affects the clock period.
26768731 Altered CRY1 and CRY2 expression patterns and the interplay with the genetic landscape in colon cancer cells may underlie phenotypic divergence.
26319354 Collectively, these data show that KPNB1 is required for timely nuclear import of PER/CRY in the negative feedback regulation of the circadian clock.
26247999 possible circadian rhythm in full-term placental expression
26218278 Overexpression of CRY1 protects against the development of atherosclerosis via the TLR/NFkappaB pathway
26168277 In men undergoing acute total sleep deprivation, there was increased methylation in the promoter of CRY1 in adipose tissue compared with controls. Also decreased gene expression in skeletal muscle.
25707907 these observations suggest a biologically plausible season-dependent association between SNPs at CRY1, CRY2 and MTNR1B and glucose homeostasis.
25391456 CRY1 and CRY2 variants showed nominal association with the metabolic syndrome components, hypertension and triglyceride levels.
25344870 SNPs in CRY1 were significantly associated with overall survival in Chinese hepatocellular carcinoma patients.
24581835 findings show the polymorphisms of Cry1 rs2287161 and Tef rs738499 are associated to major depressive disorder in the Chinese population
More...

AA Sequence

MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLN      1 - 70
SRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIE     71 - 140
LNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVW    141 - 210
PGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNS    211 - 280
SPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE    281 - 350
GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR    351 - 420
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQ    421 - 490
LSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTG    491 - 560
LSGGKRPSQEEDTQSIGPKVQRQSTN                                                561 - 586
//

Text Mined References (75)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
26966073 2016 The ratio of intracellular CRY proteins determines the clock period length.
26768731 2016 Deregulated expression of cryptochrome genes in human colorectal cancer.
26319354 2015 KPNB1 mediates PER/CRY nuclear translocation and circadian clock function.
26247999 2015 Evidence for clock genes circadian rhythms in human full-term placenta.
26218278 2015 Overexpression of CRY1 protects against the development of atherosclerosis via the TLR/NF-?B pathway.
26168277 2015 Acute Sleep Loss Induces Tissue-Specific Epigenetic and Transcriptional Alterations to Circadian Clock Genes in Men.
25707907 2015 Season-dependent associations of circadian rhythm-regulating loci (CRY1, CRY2 and MTNR1B) and glucose homeostasis: the GLACIER Study.
25391456 2015 CRY1, CRY2 and PRKCDBP genetic variants in metabolic syndrome.
25344870 2014 Functional polymorphisms of circadian negative feedback regulation genes are associated with clinical outcome in hepatocellular carcinoma patients receiving radical resection.
More...