Property Summary

Ligand Count 1
NCBI Gene PubMed Count 75
PubMed Score 400.80
PubTator Score 127.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease 1.180 3.5e-02
osteosarcoma 1.400 2.2e-05
ovarian cancer -1.400 1.4e-03
psoriasis 1.700 8.6e-05

 GO Component (2)

Protein-protein Interaction (6)

Gene RIF (48)

AA Sequence

MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLN      1 - 70
SRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIE     71 - 140
LNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVW    141 - 210
PGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNS    211 - 280
SPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQE    281 - 350
GWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR    351 - 420
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQ    421 - 490
LSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTG    491 - 560
LSGGKRPSQEEDTQSIGPKVQRQSTN                                                561 - 586
//

Text Mined References (81)

PMID Year Title