Property Summary

NCBI Gene PubMed Count 28
PubMed Score 81.39
PubTator Score 29.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.1e-04
fibroadenoma 559 6.7e-04

Expression

  Differential Expression (2)

Disease log2 FC p
fibroadenoma 2.000 6.7e-04
psoriasis 1.700 3.1e-04

Gene RIF (11)

AA Sequence

MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRK      1 - 70
EIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP                    71 - 125
//

Text Mined References (28)

PMID Year Title