Property Summary

NCBI Gene PubMed Count 22
PubMed Score 96.03
PubTator Score 75.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 6.79460837273064E-29
astrocytoma 1493 1.47339182964859E-12
oligodendroglioma 2849 2.30754307780164E-12
glioblastoma multiforme 347 1.60633752027943E-9
group 4 medulloblastoma 1875 1.53058003894692E-8
lung carcinoma 2844 3.23340166795059E-7
pilocytic astrocytoma 3086 1.19176902658952E-5
cystic fibrosis 1670 5.53932465268266E-5
pituitary cancer 1972 3.2328024625459E-4
medulloblastoma, large-cell 6234 3.50732552053305E-4
Disease Target Count Z-score Confidence
Lafora disease 9 4.034 2.0
Anterior horn cell disease 4 3.797 1.9

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma multiforme -1.100 0.000
oligodendroglioma -1.200 0.000
group 4 medulloblastoma 3.700 0.000
cystic fibrosis -1.193 0.000
medulloblastoma, large-cell 1.700 0.000
pilocytic astrocytoma -1.500 0.000
lung carcinoma 1.300 0.000
pituitary cancer -3.000 0.000
psoriasis -1.100 0.000

Synonym

Accession Q16517 B2R558 E1P5V6 Q16596 Q5U0N3
Symbols Peg5

Gene

  Ortholog (7)

Gene RIF (14)

PMID Text
24345642 Neuronatin gene: Imprinted and misfolded: Studies in Lafora disease, diabetes and cancer may implicate NNAT-aggregates as a common downstream participant in neuronal loss.
24345474 Data suggest NNAT as a potential tumor suppressor in myxoid liposarcomas.
24252747 indicate that Nnat is related to keratinocyte differentiation by up-regulating involucrin expression
23825673 methylation status of a not-yet-described regulatory element within the NNAT locus that contains four potential CTCF binding sites determines the expression level of NNAT
23408434 Neuronatin-mediated aberrant calcium signaling and endoplasmic reticulum stress underlie neuropathology in Lafora disease
22624064 Neuronatin in a subset of glioblastoma multiforme tumor progenitor cells is associated with increased cell proliferation and shorter patient survival.
22022350 A stringent analysis identified NNAT as a key imprinted gene that was dysregulated in induced pluripotent stem cells.
21742036 malin negatively regulates neuronatin and its loss of function in Lafora disease results in increased accumulation of neuronatin
19851307 A putative role of Nnat in human energy homeostasis is further emphasized by a consistent association between single nucleotide polymorphisms (SNPs) in the human Nnat gene and severe childhood and adult obesity
19218280 Loss of neuronatin expression is associated with promoter hypermethylation in pituitary adenoma.
More...

AA Sequence

MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQ      1 - 70
VLGERRQRAPN                                                                71 - 81
//

Text Mined References (23)

PMID Year Title
27109921 2016 Neuronatin is a stress-responsive protein of rod photoreceptors.
24345642 Neuronatin gene: Imprinted and misfolded: Studies in Lafora disease, diabetes and cancer may implicate NNAT-aggregates as a common downstream participant in neuronal loss.
24345474 2013 Integrative DNA methylation and gene expression analysis in high-grade soft tissue sarcomas.
24252747 2014 Neuronatin is related to keratinocyte differentiation by up-regulating involucrin.
23825673 2013 Selective methylation of CpGs at regulatory binding sites controls NNAT expression in Wilms tumors.
23408434 2013 Neuronatin-mediated aberrant calcium signaling and endoplasmic reticulum stress underlie neuropathology in Lafora disease.
22624064 2012 Neuronatin in a subset of glioblastoma multiforme tumor progenitor cells is associated with increased cell proliferation and shorter patient survival.
22022350 2011 Suppression of the imprinted gene NNAT and X-chromosome gene activation in isogenic human iPS cells.
21742036 2011 Lafora disease ubiquitin ligase malin promotes proteasomal degradation of neuronatin and regulates glycogen synthesis.
19851307 2010 The imprinted gene neuronatin is regulated by metabolic status and associated with obesity.
More...