Property Summary

NCBI Gene PubMed Count 36
Grant Count 111
R01 Count 41
Funding $26,076,926.3
PubMed Score 239.84
PubTator Score 67.22

Knowledge Summary

Patent (25,126)

Expression

  Differential Expression (11)

Synonym

Accession Q16515 E9PBX2 Q13553 Q6DJU1 Q8N3E2 ASIC2
Symbols ACCN
BNC1
MDEG
ACCN1
BNaC1
ASIC2a
hBNaC1

Gene

PANTHER Protein Class (2)

Gene RIF (19)

PMID Text
26617738 results demonstrate the occurrence of ASIC2 and TrkB in the human intervertebral disc (IVD), and the increased expression of both in pathological IVD suggest their involvement in IVD degeneration
26033064 This study suggests that ASIC2 may play a role as mediators of inflammatory pain and be involved in the pathogenesis of frozen shoulder.
25224144 distribution of ASIC2 in the human cutaneous mechanosensory system and suggest the involvement of ASIC2 in mechanosensation
24847067 Combinatorial analysis suggests a model of random mixing of ASIC1a and ASIC2a subunits to yield both 2:1 and 1:2 ASIC1a:ASIC2a heteromers together with ASIC1a and ASIC2a homomers.
22157923 The results showed that there was a significant increase in the mean relative optical density of ASIC2 and ASIC3 but not ASIC1a in the lining epithelium and glandular tubes of gastric mucosa in patients with Henoch-Schonlein purpura.
21961650 these results indicate that ACCN1 gene is a potential candidate for response to lithium treatment that would serve as a genetic marker of lithium efficacy for bipolar disorder patients.
21811305 ACCN1 might be one of numerous susceptibility genes for panic disorder.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20306292 These results demonstrate for the first time the differential distribution of ASIC1 and ASIC2 in human rapidly adapting low-threshold mechanoreceptors, and suggest specific roles of both proteins in mechanotransduction.
More...

AA Sequence

MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVESSERVSYYFSY      1 - 70
QHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVNLQIPDPHLADPSVLEALRQK     71 - 140
ANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKYGKCYMFNSGEDGKPLLTTVK    141 - 210
GGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLT    211 - 280
YLPPPWGECRSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLL    281 - 350
AEKDSNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK    351 - 420
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHSE    421 - 490
TISHTVNVPLQTTLGTLEEIAC                                                    491 - 512
//

Text Mined References (38)

PMID Year Title
26617738 2015 Acid-sensing ion channel 2 (asic 2) and trkb interrelationships within the intervertebral disc.
26033064 2015 Up-regulation of acid-sensing ion channels in the capsule of the joint in frozen shoulder.
25224144 2015 ASIC2 is present in human mechanosensory neurons of the dorsal root ganglia and in mechanoreceptors of the glabrous skin.
24847067 2014 Acid-sensing ion channel (ASIC) 1a/2a heteromers have a flexible 2:1/1:2 stoichiometry.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22157923 2012 Expression of acid-sensing ion channels of gastric mucosa from patients with Henoch-Schönlein purpura.
21961650 2011 Evidence for association of an ACCN1 gene variant with response to lithium treatment in Sardinian patients with bipolar disorder.
More...