Property Summary

NCBI Gene PubMed Count 44
PubMed Score 12.44
PubTator Score 15.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma 1.098 1.6e-05

Gene RIF (16)

AA Sequence

MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREV      1 - 70
DPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYK     71 - 140
KACTTEAHKQRMALIRKTTKK                                                     141 - 161
//

Text Mined References (50)

PMID Year Title