Property Summary

NCBI Gene PubMed Count 80
Grant Count 40
R01 Count 27
Funding $3,030,677.06
PubMed Score 116.25
PubTator Score 70.52

Knowledge Summary

Patent (23,344)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.100 0.001
osteosarcoma -1.563 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.500 0.000
pediatric high grade glioma 1.100 0.000
ovarian cancer 1.500 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (25)

PMID Text
26296974 TXA2-mediated neoplastic responses in prostate adenocarcinoma PC-3 cells occur through a PRK1/PRK2-dependent mechanism.
25504435 Transcriptome and interactome analyses uncover that PRK1 regulates expression of migration-relevant genes by interacting with the scaffold protein sperm-associated antigen 9 (SPAG9/JIP4).
24248594 Data indicate that Salmonella SspH1 catalyzes the ubiquitination and proteasome-dependent degradation of PKN1 in cells.
24114839 Protein kinase N1 inhibits Wnt/b-catenin signaling and apoptosis in melanoma cells.
22893700 Protein kinase N1 is a novel substrate of NFATc1-mediated cyclin D1-CDK6 activity and modulates vascular smooth muscle cell division and migration leading to inward blood vessel wall remodeling.
21754995 PKN isoforms are not simply redundant in supporting migration, but appear to be linked through isoform specific regulatory domain properties to selective upstream signals. It
21357687 PRK1 is a bona fide interactant of TPalpha/TPbeta, and leading to H3 Thr(11) phosphorylation to regulate cell migration
21351730 Data show that just one contact site as being relevant for binding of RhoA and domain from PRK1, and the HR1b domain was found not to contribute to RhoA binding.
21224381 A-kinase anchoring protein (AKAP)-Lbc anchors a PKN-based signaling complex involved in alpha1-adrenergic receptor-induced p38 activation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSL      1 - 70
GPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTCSATNLSRVAGLEKQLAIELK     71 - 140
VKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQAGQLENQAAPDDTQGSPDLGA    141 - 210
VELRIEELRHHFRVEHAVAEGAKNVLRLLSAAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPA    211 - 280
DHPKGRLLREELAAASSAAFSTRLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPSMGG    281 - 350
PGTPDSRPPFLSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFT    351 - 420
LELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPVIERIPRLRRQ    421 - 490
KKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATGTGTFSPGASPGSEARTTGDISVEKLNLGTDSD    491 - 560
SSPQKSSRDPPSSPSSLSSPIQESTAPELPSETQETPGPALCSPLRKSPLTLEDFKFLAVLGRGHFGKVL    561 - 630
LSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAG    631 - 700
GDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGD    701 - 770
RTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSA    771 - 840
EAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTG    841 - 910
EAPTLSPPRDARPLTAAEQAAFLDFDFVAGGC                                          911 - 942
//

Text Mined References (95)

PMID Year Title
26296974 2015 Protein kinase C-related kinase 1 and 2 play an essential role in thromboxane-mediated neoplastic responses in prostate cancer.
25504435 2014 PRK1/PKN1 controls migration and metastasis of androgen-independent prostate cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24248594 2014 Structure of an SspH1-PKN1 complex reveals the basis for host substrate recognition and mechanism of activation for a bacterial E3 ubiquitin ligase.
24114839 2013 Protein kinase PKN1 represses Wnt/?-catenin signaling in human melanoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22893700 2012 Protein kinase N1 is a novel substrate of NFATc1-mediated cyclin D1-CDK6 activity and modulates vascular smooth muscle cell division and migration leading to inward blood vessel wall remodeling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21754995 2011 Regulatory domain selectivity in the cell-type specific PKN-dependence of cell migration.
More...