Property Summary

NCBI Gene PubMed Count 18
Grant Count 29
R01 Count 18
Funding $2,584,340.62
PubMed Score 119.85
PubTator Score 53.18

Knowledge Summary

Patent (6,027)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.100 0.000
osteosarcoma 1.705 0.000
group 4 medulloblastoma 2.300 0.000
medulloblastoma, large-cell 1.400 0.000
atypical teratoid/rhabdoid tumor -1.100 0.005
subependymal giant cell astrocytoma -1.215 0.037
lung carcinoma 1.600 0.000

 GWAS Trait (1)

Gene RIF (7)

PMID Text
23288040 CaMKII-dependent phosphorylation of GluK5 is responsible for synaptic depression by untrapping of KARs from the PSD and increased diffusion away from synaptic sites.
19125103 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18247129 Functional dysregulation of glutamate uptake was associated with early increases in mRNA and protein expression of the glial glutamate transporter EAAT-2 followed by a sustained decrease in mRNA expression in astrocytes infected with both HHV-6A & HHV-6B.
16325263 Observational study of gene-disease association. (HuGE Navigator)
15254951 GRIK 5 gene is linked to rapid-onset dystonia-parkinsonism.
14511640 characterization the trafficking and surface expression of KA2

AA Sequence

MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAKARVEVDIFEL      1 - 70
QRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYP     71 - 140
SNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRGFLISKETLSVRMLDDSRDPTPLLKEIRDDK    141 - 210
VSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEF    211 - 280
VRSLNMSWRENCEASTYLGPALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYL    281 - 350
RMVEYDGLTGRVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT    351 - 420
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELIN    421 - 490
RKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCV    491 - 560
LFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLI    561 - 630
IISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSV    631 - 700
FVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQ    701 - 770
ENNRLEILKRKWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS    771 - 840
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAGSAHGGPQRLL    841 - 910
DDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEATSPPRPRPGPAGPRELAEHE    911 - 980
//

Text Mined References (18)

PMID Year Title
23288040 2013 CaMKII-dependent phosphorylation of GluK5 mediates plasticity of kainate receptors.
21771265 2011 Genome-wide association study on bipolar disorder in the Bulgarian population.
19342380 2009 Glutamate binding and conformational flexibility of ligand-binding domains are critical early determinants of efficient kainate receptor biogenesis.
19125103 2009 Association analysis of the glutamic acid decarboxylase 2 and the glutamine synthetase genes (GAD2, GLUL) with schizophrenia.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18247129 2008 Human herpesvirus 6 (HHV-6) induces dysregulation of glutamate uptake and transporter expression in astrocytes.
16325263 2006 Association study of polymorphisms in the GluR7, KA1 and KA2 kainate receptor genes (GRIK3, GRIK4, GRIK5) with schizophrenia.
15254951 2004 Refined linkage to the RDP/DYT12 locus on 19q13.2 and evaluation of GRIK5 as a candidate gene.
14511640 2003 Trafficking and surface expression of the glutamate receptor subunit, KA2.
12573530 2003 Heteromer formation of delta2 glutamate receptors with AMPA or kainate receptors.
More...