Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.2e-05

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 5.2e-05

Gene RIF (2)

AA Sequence

MEDKNGAPHGAPHSDSPLGFSHAAPEEDTPAPELAPEAPEPPEEPRLGVLTVTDTTPDSMRLSWSVAQGP      1 - 70
FDSFVVQYEDTNGQPQALLVDGDQSKILISGLEPSTPYRFLLYGLHEGKRLGPLSAEGTTGLAPAGQTSE     71 - 140
ESRPRLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSTLEPHPRPLLQRELMVPGTRHSAVLRD    141 - 210
LRSGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFSEIRETSAKVNWMPPPSRADSFKVSYQL    211 - 280
ADGGEPQSVQVDGRARTQKLQFLTVPHSCVH                                           281 - 311
//

Text Mined References (11)

PMID Year Title